PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009118127.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 183aa MW: 20951.1 Da PI: 10.3524 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 70.3 | 1.8e-22 | 18 | 61 | 2 | 45 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45 +ie +s rqv fskRr+g++KKA+EL++LC++eva+i+fs+ k XP_009118127.1 18 KIEKESHRQVAFSKRRAGLFKKASELCTLCGVEVAIIVFSPAKK 61 69**************************************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 7.8E-29 | 9 | 68 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 23.1 | 9 | 69 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.69E-33 | 10 | 86 | No hit | No description |
SuperFamily | SSF55455 | 1.83E-28 | 10 | 89 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.7E-17 | 11 | 31 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.2E-25 | 18 | 65 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.7E-17 | 31 | 46 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.7E-17 | 46 | 67 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 183 aa Download sequence Send to blast |
MTSKKKGSTG RQRIRMAKIE KESHRQVAFS KRRAGLFKKA SELCTLCGVE VAIIVFSPAK 60 KPFSFGHPSV YSVLDRYRNN TSFQQQSQPR ENTATRSELS LVLSQLEEEK KKGEEMRKAS 120 EMAKWSVDEM SLLQLQEMRY ALEELRKTMV VPPPSYMNSM STGFSCIYNS SYVHASSRVT 180 YKL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6bz1_A | 9e-15 | 10 | 94 | 2 | 83 | MEF2 CHIMERA |
6bz1_B | 9e-15 | 10 | 94 | 2 | 83 | MEF2 CHIMERA |
6bz1_C | 9e-15 | 10 | 94 | 2 | 83 | MEF2 CHIMERA |
6bz1_D | 9e-15 | 10 | 94 | 2 | 83 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in the final stages of embryo sac development. {ECO:0000269|PubMed:18713950}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed exclusively in the central cell of the female gametophyte and in early endosperm. {ECO:0000269|PubMed:18599653, ECO:0000269|PubMed:18713950}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Controls central cell differentiation during female gametophyte development. {ECO:0000269|PubMed:18599653, ECO:0000269|PubMed:18713950}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009118127.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009118127.1 | 1e-134 | PREDICTED: agamous-like MADS-box protein AGL61 | ||||
Refseq | XP_022547594.1 | 1e-134 | agamous-like MADS-box protein AGL61 | ||||
Swissprot | Q4PSU4 | 2e-61 | AGL61_ARATH; Agamous-like MADS-box protein AGL61 | ||||
TrEMBL | A0A397Y5G3 | 1e-133 | A0A397Y5G3_BRACM; Uncharacterized protein | ||||
STRING | Bra026764.1-P | 1e-122 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM86 | 28 | 390 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G24840.1 | 3e-52 | AGAMOUS-like 61 |
Publications ? help Back to Top | |||
---|---|---|---|
|