PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013627332.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 190aa MW: 21806.1 Da PI: 8.9512 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 103.2 | 1.4e-32 | 115 | 172 | 1 | 58 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+Hnh XP_013627332.1 115 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHNH 172 59******************************************************** PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 4.0E-34 | 100 | 172 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.05E-28 | 107 | 172 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.585 | 110 | 172 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.3E-37 | 115 | 174 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.4E-25 | 116 | 172 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 190 aa Download sequence Send to blast |
MNFPFEETNV LTFFSSSSSS LSSPSFPIYN SSSTTNTTYA PLGFSNNLQD GGPLGSKVVN 60 DDQDNIRGGI NNDVHSNSWW RSSSESGEMK NKVKIRRKLR EPRFCFQTKS DVDVLDDGYK 120 WRKYGQKVVK NSLHPRSYYR CTHNNCRVKK RVERLSEDCR MVITTYEGRH NHIPSDDSTS 180 PERDHCLSSF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 8e-27 | 106 | 172 | 8 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 8e-27 | 106 | 172 | 8 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 93 | 99 | KIRRKLR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013627332.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | GQ168839 | 0.0 | GQ168839.1 Brassica rapa subsp. pekinensis WRKY12 mRNA, complete cds. | |||
GenBank | KF430034 | 0.0 | KF430034.1 Brassica rapa WRKY transcription factor 12 (WRKY12) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013627332.1 | 1e-140 | PREDICTED: probable WRKY transcription factor 12 | ||||
Refseq | XP_022553833.1 | 1e-140 | probable WRKY transcription factor 12 | ||||
Swissprot | Q93WY4 | 1e-110 | WRK12_ARATH; Probable WRKY transcription factor 12 | ||||
TrEMBL | A0A3P6AXH8 | 1e-139 | A0A3P6AXH8_BRAOL; Uncharacterized protein (Fragment) | ||||
STRING | Bo3g037400.1 | 1e-139 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6045 | 25 | 46 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G44745.1 | 2e-98 | WRKY family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|