PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013625451.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 219aa MW: 25042.1 Da PI: 8.3614 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57.1 | 4e-18 | 42 | 87 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T++E+ l +++++++G++ W++Iar+++ gRt++++k++w++++ XP_013625451.1 42 RGKMTPQEEHLVLELHTKWGNR-WSKIARKLP-GRTDNEIKNYWRTHM 87 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50090 | 4.67 | 1 | 36 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 7.2E-10 | 22 | 48 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 4.18E-22 | 22 | 92 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 27 | 37 | 91 | IPR017930 | Myb domain |
SMART | SM00717 | 2.8E-15 | 41 | 89 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.7E-16 | 42 | 86 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.45E-11 | 44 | 87 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.2E-20 | 49 | 88 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 219 aa Download sequence Send to blast |
MGFCSESVRF EGGGRNIRLG LNRTGKSCRL RWVNYLHPGL KRGKMTPQEE HLVLELHTKW 60 GNRWSKIARK LPGRTDNEIK NYWRTHMRKK AQEKKRPMSP TSSSSNCCSS SMTTAATQDT 120 GGSNGKMNQE CEDGYYSMDD IWREIDQSGA NIIKPVKDIY YSEQNCYLDF PPLASPAWES 180 SMESIWNMDA DESNMSSFAI DQFPLSFEHG RSSSWSSLL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 2e-17 | 23 | 91 | 37 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1h88_C | 5e-17 | 23 | 91 | 91 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 5e-17 | 23 | 91 | 91 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1h8a_C | 3e-17 | 23 | 91 | 60 | 128 | MYB TRANSFORMING PROTEIN |
1mse_C | 2e-17 | 23 | 91 | 37 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 2e-17 | 23 | 91 | 37 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Mainly expressed in leaves and seedlings, and to a lower extent, in roots, stems and inflorescences. Isoform MYB59-1 and isoform MYB59-2 are present in roots, leaves, and seedlings, while the expression of isoform MYB59-3 and isoform MYB59-4 is confined to seedlings. {ECO:0000269|PubMed:16531467}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. {ECO:0000305}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00600 | PBM | Transfer from AT5G59780 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013625451.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Isoform MYB59-1 is induced by jasmonate (JA), salicylic acid (SA), gibberellic acid (GA), and ethylene. Also induced by cadmium (Cd). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:16531467}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | DQ075253 | 0.0 | DQ075253.1 Arabidopsis thaliana MYB transcription factor MYB59-2 (At5g59780) mRNA, complete cds, alternatively spliced. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013625451.1 | 1e-165 | PREDICTED: transcription factor MYB59 isoform X2 | ||||
Swissprot | Q4JL84 | 1e-124 | MYB59_ARATH; Transcription factor MYB59 | ||||
TrEMBL | A0A0D3B2J6 | 1e-148 | A0A0D3B2J6_BRAOL; Uncharacterized protein | ||||
STRING | Bo3g017760.1 | 1e-149 | (Brassica oleracea) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G59780.2 | 1e-121 | myb domain protein 59 |
Publications ? help Back to Top | |||
---|---|---|---|
|