PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013610699.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 171aa MW: 19039.8 Da PI: 6.016 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 100.9 | 7.5e-32 | 110 | 168 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K+vk+s++pr+YY+C+ gCpvkk+ver+++dp++v++tYeg Hnh+ XP_013610699.1 110 LDDGFKWRKYGKKMVKNSPNPRNYYKCSADGCPVKKRVERDRDDPSFVITTYEGFHNHS 168 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 7.1E-34 | 96 | 169 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.22E-28 | 103 | 168 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 30.136 | 105 | 170 | IPR003657 | WRKY domain |
SMART | SM00774 | 5.5E-37 | 110 | 169 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.9E-25 | 111 | 167 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 171 aa Download sequence Send to blast |
MNDAETNLAR SFSDDTHSGL DHPDLYLSDE WMDDDLASAV SGMNQSYPYQ TSDAAAFFSG 60 SSSSLGHPES SSTNASAATA TASAENQVKK ENKKVKERVA FKTQSEVEVL DDGFKWRKYG 120 KKMVKNSPNP RNYYKCSADG CPVKKRVERD RDDPSFVITT YEGFHNHSSM R |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-26 | 100 | 167 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 1e-26 | 100 | 167 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013610699.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013610699.1 | 1e-126 | PREDICTED: probable WRKY transcription factor 50 | ||||
Swissprot | Q8VWQ5 | 3e-91 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
TrEMBL | A0A0D3E1A3 | 1e-125 | A0A0D3E1A3_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6DMV7 | 1e-125 | A0A3P6DMV7_BRAOL; Uncharacterized protein | ||||
STRING | Bo9g011080.1 | 1e-125 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6121 | 27 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 2e-71 | WRKY DNA-binding protein 50 |
Publications ? help Back to Top | |||
---|---|---|---|
|