PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013601550.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 180aa MW: 19707.5 Da PI: 10.572 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 58 | 1.3e-18 | 40 | 74 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C+ Cgt kTplWR gp g+k+LCnaCG++ rkk++ XP_013601550.1 40 CVDCGTNKTPLWRGGPAGPKSLCNACGIKSRKKRQ 74 *********************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 2.2E-10 | 34 | 89 | IPR000679 | Zinc finger, GATA-type |
PROSITE profile | PS50114 | 12.031 | 34 | 70 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 3.94E-12 | 35 | 78 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 1.3E-14 | 38 | 74 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 2.81E-11 | 39 | 73 | No hit | No description |
Pfam | PF00320 | 2.3E-16 | 40 | 74 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 40 | 65 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 180 aa Download sequence Send to blast |
MSMTEETKTT TKLETAGDSS DVESGNCSSS GSGGDTKKTC VDCGTNKTPL WRGGPAGPKS 60 LCNACGIKSR KKRQAALGIR QEDNNNKIKN KTNNSLPLDH QTIKNRKGES GNVKNKIKTT 120 ESENFISRVN KKSLERASRF LDLGFKVPAM KRSVVEKKRL WRKLGEEERA AVLLMTLSCG |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013601550.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK119021 | 6e-43 | AK119021.1 Arabidopsis thaliana At4g16141 mRNA for unknown protein, complete cds, clone: RAFL21-34-K14. | |||
GenBank | AK228025 | 6e-43 | AK228025.1 Arabidopsis thaliana mRNA for hypothetical protein, partial sequence., clone: RAFL14-54-B16. | |||
GenBank | AL161543 | 6e-43 | AL161543.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 43. | |||
GenBank | CP002687 | 6e-43 | CP002687.1 Arabidopsis thaliana chromosome 4 sequence. | |||
GenBank | Z97340 | 6e-43 | Z97340.2 Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig fragment No. 5. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013601550.1 | 1e-128 | PREDICTED: GATA transcription factor 17-like | ||||
Refseq | XP_013680437.1 | 1e-128 | GATA transcription factor 17-like | ||||
Refseq | XP_013699138.1 | 1e-128 | GATA transcription factor 17-like | ||||
Swissprot | Q9LIB5 | 5e-59 | GAT17_ARATH; GATA transcription factor 17 | ||||
TrEMBL | A0A0D3A7R4 | 1e-127 | A0A0D3A7R4_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3N6UEQ3 | 1e-127 | A0A3N6UEQ3_BRACR; Uncharacterized protein | ||||
STRING | Bo1g055120.1 | 1e-128 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM13816 | 16 | 24 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G16141.1 | 2e-60 | GATA family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|