PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013585238.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 301aa MW: 33694.9 Da PI: 8.9274 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 162.1 | 2.1e-50 | 18 | 143 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 +ppGfrFhPtdeel++++L kkv ++++++ +i++vd ++Pw+Lp+k+k +ekewyfF++rd+ky+tg r+nrat++gyWkatgkd+e++s+ XP_013585238.1 18 MPPGFRFHPTDEELITYFLLKKVLDSNFSC-AAISQVDX--SKPWELPEKAKMGEKEWYFFTRRDRKYPTGLRTNRATEAGYWKATGKDREIKSS 109 79**************************99.78999986..67*****99999****************************************98 PP NAM 96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128 +++l g+kktLvfykgrapkgek+ Wvmheyrl XP_013585238.1 110 kTNSLLGMKKTLVFYKGRAPKGEKSCWVMHEYRL 143 56677***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.23E-56 | 15 | 168 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 53.481 | 18 | 168 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.5E-28 | 19 | 143 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 301 aa Download sequence Send to blast |
MDVFNGWERS RLEDETIMPP GFRFHPTDEE LITYFLLKKV LDSNFSCAAI SQVDXSKPWE 60 LPEKAKMGEK EWYFFTRRDR KYPTGLRTNR ATEAGYWKAT GKDREIKSSK TNSLLGMKKT 120 LVFYKGRAPK GEKSCWVMHE YRLDGKFSYH YITSSAKDEW VLSKVCLKSS VVSRETKLVS 180 SSSVSVTSIS CSSSTGSLIA PVIDAFATEH VSCFSNTSAS HVDASFPIYL PAPPQSLPRQ 240 PRRIDDVAFG QFMGLGSTGQ FNIDAAFLPN LPSLPPTFLH PPPQXYAPYG GAAVSCWPFA 300 L |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 3e-46 | 18 | 174 | 17 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 3e-46 | 18 | 174 | 17 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 3e-46 | 18 | 174 | 17 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 3e-46 | 18 | 174 | 17 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 3e-46 | 18 | 174 | 20 | 174 | NAC domain-containing protein 19 |
3swm_B | 3e-46 | 18 | 174 | 20 | 174 | NAC domain-containing protein 19 |
3swm_C | 3e-46 | 18 | 174 | 20 | 174 | NAC domain-containing protein 19 |
3swm_D | 3e-46 | 18 | 174 | 20 | 174 | NAC domain-containing protein 19 |
3swp_A | 3e-46 | 18 | 174 | 20 | 174 | NAC domain-containing protein 19 |
3swp_B | 3e-46 | 18 | 174 | 20 | 174 | NAC domain-containing protein 19 |
3swp_C | 3e-46 | 18 | 174 | 20 | 174 | NAC domain-containing protein 19 |
3swp_D | 3e-46 | 18 | 174 | 20 | 174 | NAC domain-containing protein 19 |
4dul_A | 3e-46 | 18 | 174 | 17 | 171 | NAC domain-containing protein 19 |
4dul_B | 3e-46 | 18 | 174 | 17 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: First observed in young embryonic SAM. Later confined to the boundaries between cotyledon primordia and the SAM. In mature embryos, localized around first leaves primordia. Only weakly present in vegetative SAM. In inflorescence, observed at the boundaries between floral organ primordia. In callus, expressed during transition to shoot development, with a progressive restriction to specific areas corresponding to future shoot apex. {ECO:0000269|PubMed:11245578, ECO:0000269|PubMed:12492830}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in inflorescence stems, rosette leaves, aerial parts of seedlings, flowers, floral buds and roots. {ECO:0000269|PubMed:11245578}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator of STM and KNAT6. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for the fusion of septa of gynoecia along the length of the ovaries. Activates the shoot formation in callus in a STM-dependent manner. Seems to act as an inhibitor of cell division. {ECO:0000269|PubMed:10079219, ECO:0000269|PubMed:10750709, ECO:0000269|PubMed:11245578, ECO:0000269|PubMed:12163400, ECO:0000269|PubMed:12492830, ECO:0000269|PubMed:12610213, ECO:0000269|PubMed:12787253, ECO:0000269|PubMed:14617069, ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15500463, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16798887, ECO:0000269|PubMed:17122068, ECO:0000269|PubMed:17287247, ECO:0000269|PubMed:9212461}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013585238.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. Directly induced by ESR2 in response to cytokinins. Precise spatial regulation by post-transcriptional repression directed by the microRNA miR164. {ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16854978, ECO:0000269|PubMed:17056621, ECO:0000269|PubMed:17287247}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JN169820 | 0.0 | JN169820.1 Brassica napus isolate Bna1 CUC1-like gene, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013585238.1 | 0.0 | PREDICTED: LOW QUALITY PROTEIN: protein CUP-SHAPED COTYLEDON 1 | ||||
Swissprot | Q9FRV4 | 1e-146 | NAC54_ARATH; Protein CUP-SHAPED COTYLEDON 1 | ||||
TrEMBL | A0A0D3BBF7 | 1e-174 | A0A0D3BBF7_BRAOL; Uncharacterized protein | ||||
STRING | Bo3g066690.1 | 1e-175 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM13481 | 15 | 28 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G15170.1 | 1e-126 | NAC family protein |