PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00151786001 | ||||||||
Common Name | GSBRNA2T00151786001, LOC106429924 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 199aa MW: 23017.8 Da PI: 9.1037 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 60.2 | 4.6e-19 | 18 | 65 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT eEd++l d+vk +G+g+W++Ia++ g++R++k+c++rw +yl GSBRNA2T00151786001 18 KGLWTVEEDKILMDYVKAHGKGHWNRIAKKTGLKRCGKSCRLRWMNYL 65 678*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 61.6 | 1.6e-19 | 71 | 116 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T++E++l+++++k+lG++ W++Ia++++ gRt++q+k++w+++l GSBRNA2T00151786001 71 RGNFTEQEEDLIIRLHKLLGNR-WSLIAKRVP-GRTDNQVKNYWNTHL 116 89********************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 18.95 | 13 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.15E-31 | 16 | 112 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.6E-15 | 17 | 67 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.8E-17 | 18 | 65 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.3E-25 | 19 | 72 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.25E-11 | 21 | 65 | No hit | No description |
PROSITE profile | PS51294 | 28.737 | 66 | 120 | IPR017930 | Myb domain |
SMART | SM00717 | 5.6E-19 | 70 | 118 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.7E-18 | 71 | 116 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 9.6E-28 | 73 | 120 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.83E-13 | 73 | 116 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 199 aa Download sequence Send to blast |
MRKKVSSSGE EGNNEYKKGL WTVEEDKILM DYVKAHGKGH WNRIAKKTGL KRCGKSCRLR 60 WMNYLSPNVK RGNFTEQEED LIIRLHKLLG NRWSLIAKRV PGRTDNQVKN YWNTHLSKKL 120 GNKDPKTKPS NGDIVHQINL TNPTETLEET NISNINDNSE FQEDRQGSNY LSSHWVHDDE 180 FELSSLTNML DFIDGHCF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-29 | 18 | 120 | 7 | 108 | B-MYB |
1h8a_C | 3e-29 | 13 | 120 | 22 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Restricted to roots and hypocotyl. Specifically expressed in root non-hair developing cells (atrichoblasts) at the N position. Also present in lateral root cap cells. In hypocotyls, expressed within files of epidermal cells located outside a single cortical cell equivalent to roots N cells (at protein level). {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:16207757}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00151786001 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HQ317141 | 0.0 | HQ317141.1 Brassica rapa subsp. rapa cultivar Tsuda MYB domain protein 66 (MYB66) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013726146.1 | 1e-146 | transcription factor WER | ||||
Swissprot | Q9SEI0 | 1e-131 | WER_ARATH; Transcription factor WER | ||||
TrEMBL | A0A0D3AJ34 | 1e-143 | A0A0D3AJ34_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6CUN7 | 1e-143 | A0A3P6CUN7_BRAOL; Uncharacterized protein | ||||
STRING | Bo2g012170.1 | 1e-144 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G14750.1 | 1e-124 | myb domain protein 66 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 106429924 |