PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00151174001 | ||||||||
Common Name | GSBRNA2T00151174001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 148aa MW: 15825 Da PI: 9.6702 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 59.5 | 4.3e-19 | 39 | 73 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C+ Cgt+kTplWR gp g+k+LCnaCG++ rkk++ GSBRNA2T00151174001 39 CVDCGTSKTPLWRGGPAGPKSLCNACGIKSRKKRQ 73 *********************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50114 | 12.189 | 33 | 69 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 1.1E-11 | 33 | 94 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 1.43E-12 | 34 | 76 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 2.9E-15 | 37 | 73 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 3.09E-12 | 38 | 72 | No hit | No description |
Pfam | PF00320 | 6.2E-17 | 39 | 73 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 39 | 64 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 148 aa Download sequence Send to blast |
MSMTEETKTT KLESAGETSD VENGNCSSSG SGGDTKKTCV DCGTSKTPLW RGGPAGPKSL 60 CNACGIKSRK KRQAAHGIKQ EDNNNKIKKN KSSNDLALDD QTVKSKIKTG TEDLPVMKRS 120 VVEKKRLWMK MGEEERAAVL LMALSCG* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Bna.10797 | 0.0 | microspore-derived embryo| seed |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00151174001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC189632 | 6e-92 | AC189632.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrS003O10, complete sequence. | |||
GenBank | AC232469 | 6e-92 | AC232469.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB026A07, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013737390.1 | 2e-76 | GATA transcription factor 17-like | ||||
Refseq | XP_013738174.1 | 2e-76 | GATA transcription factor 17-like | ||||
Swissprot | Q9LIB5 | 9e-50 | GAT17_ARATH; GATA transcription factor 17 | ||||
TrEMBL | A0A3P5ZYV3 | 9e-74 | A0A3P5ZYV3_BRACM; Uncharacterized protein | ||||
STRING | Bra012742.1-P | 3e-74 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM13816 | 16 | 24 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G16141.1 | 1e-54 | GATA family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|