PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00144621001 | ||||||||
Common Name | GSBRNA2T00144621001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | B3 | ||||||||
Protein Properties | Length: 111aa MW: 12753.9 Da PI: 9.9182 | ||||||||
Description | B3 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 35.1 | 2.3e-11 | 53 | 109 | 17 | 75 |
E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT-- CS B3 17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLk 75 vlp f++ +++ + k ++l d++g +W++kl ++k ++r+ l +GWkeF +an++k GSBRNA2T00144621001 53 VLPIAFTKLNKIRMA--KRMSLLDKHGVKWSIKLWFEKERKRMRLVGGWKEFYDANDVK 109 899999988877644..57***************88********************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.40.330.10 | 1.4E-10 | 52 | 109 | IPR015300 | DNA-binding pseudobarrel domain |
Pfam | PF02362 | 1.7E-9 | 52 | 109 | IPR003340 | B3 DNA binding domain |
SuperFamily | SSF101936 | 5.89E-12 | 53 | 109 | IPR015300 | DNA-binding pseudobarrel domain |
PROSITE profile | PS50863 | 10.771 | 53 | 110 | IPR003340 | B3 DNA binding domain |
CDD | cd10017 | 7.79E-11 | 53 | 109 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 111 aa Download sequence Send to blast |
MEESQQEPQE GGKSSYVQWS PQENNTLINL LLDCITAVHG FGFLVSLLSL AQVLPIAFTK 60 LNKIRMAKRM SLLDKHGVKW SIKLWFEKER KRMRLVGGWK EFYDANDVKI * |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00144621001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC189633 | 1e-121 | AC189633.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrS004A14, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020888131.1 | 2e-24 | putative B3 domain-containing protein REM15 | ||||
Swissprot | O23076 | 1e-15 | REM15_ARATH; Putative B3 domain-containing protein REM15 | ||||
TrEMBL | A0A3P5YLC4 | 7e-76 | A0A3P5YLC4_BRACM; Uncharacterized protein | ||||
TrEMBL | M4E945 | 7e-76 | M4E945_BRARP; Uncharacterized protein | ||||
STRING | Bra025301.1-P | 1e-76 | (Brassica rapa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G00260.1 | 6e-18 | B3 family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|