PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00143241001 | ||||||||
Common Name | GSBRNA2T00143241001, LOC106364602, LOC106390409 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 189aa MW: 21921.1 Da PI: 6.3941 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 43.7 | 6.1e-14 | 73 | 129 | 4 | 60 |
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 ++++rr+ +NRe+ArrsR RK+ ++eL v+ L +eN++L ++l++ ++ + + GSBRNA2T00143241001 73 DRKQRRMVSNRESARRSRMRKQRHLDELLSQVAWLRSENQQLLDKLNQASDSNDLVL 129 689*******************************************99888776555 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 3.8E-12 | 70 | 134 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.542 | 72 | 120 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 7.5E-11 | 73 | 125 | No hit | No description |
Pfam | PF00170 | 6.0E-12 | 73 | 131 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 8.75E-13 | 74 | 123 | No hit | No description |
CDD | cd14702 | 1.08E-18 | 75 | 122 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 77 | 92 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 189 aa Download sequence Send to blast |
MQPNYDSSSL NSMQQQDYFH LNHYYNNLNP STNINNLNLI PYPQIHQEFN LQSPGNNSTT 60 SDEATEDIFV INDRKQRRMV SNRESARRSR MRKQRHLDEL LSQVAWLRSE NQQLLDKLNQ 120 ASDSNDLVLQ ENLRLKEENV ELRQVITSMK KLGGSTSIQG RYCSSSLDHE LDQDFSCITN 180 DPRTHHPS* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 86 | 93 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00143241001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC240087 | 0.0 | AC240087.1 Brassica oleracea clone BOT01-44D22, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009126070.1 | 1e-136 | PREDICTED: basic leucine zipper 43-like | ||||
Refseq | XP_013659596.1 | 1e-136 | basic leucine zipper 43-like | ||||
Swissprot | Q9FMC2 | 4e-30 | BZP43_ARATH; Basic leucine zipper 43 | ||||
TrEMBL | A0A3P5ZWT7 | 1e-135 | A0A3P5ZWT7_BRACM; Uncharacterized protein | ||||
TrEMBL | M4E437 | 1e-135 | M4E437_BRARP; Uncharacterized protein | ||||
STRING | Bra023540.1-P | 1e-136 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM10632 | 15 | 32 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G15830.1 | 2e-90 | basic leucine-zipper 3 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 106364602 | 106390409 |
Publications ? help Back to Top | |||
---|---|---|---|
|