PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00121181001 | ||||||||
Common Name | GSBRNA2T00121181001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 223aa MW: 26169.4 Da PI: 10.7825 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 27 | 7.5e-09 | 135 | 173 | 18 | 54 |
HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS Homeobox 18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 +F++ ++yp+ +e+ LA + gLt +qV++WF N R + GSBRNA2T00121181001 135 MFQNflHPYPKDSEKHLLAIRSGLTRSQVSNWFINARVR 173 6887779******************************98 PP | |||||||
2 | BELL | 91.7 | 7e-30 | 12 | 80 | 3 | 72 |
BELL 3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 +l++kk++Ll+ll++Vd+rY+++v++++tv+s+F+a+++l++ +++t++Al+++S+ +++L+++i+++i GSBRNA2T00121181001 12 GALEAKKTHLLDLLQMVDDRYSHCVDEIHTVVSAFHAATELDP-QLHTRFALQTVSFLYKNLRERISKKI 80 6899***************************************.************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00574 | 2.5E-8 | 1 | 78 | IPR006563 | POX domain |
Pfam | PF07526 | 2.5E-20 | 11 | 77 | IPR006563 | POX domain |
PROSITE profile | PS50071 | 10.981 | 114 | 177 | IPR001356 | Homeobox domain |
CDD | cd00086 | 7.74E-9 | 117 | 178 | No hit | No description |
SMART | SM00389 | 1.1E-4 | 117 | 181 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 2.31E-15 | 118 | 186 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.1E-25 | 120 | 183 | IPR009057 | Homeodomain-like |
Pfam | PF05920 | 5.3E-15 | 134 | 173 | IPR008422 | Homeobox KN domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 223 aa Download sequence Send to blast |
MLLFFSRNRV RGALEAKKTH LLDLLQMVDD RYSHCVDEIH TVVSAFHAAT ELDPQLHTRF 60 ALQTVSFLYK NLRERISKKI LMMGTVLERG KEKSQEDSIF HQHCLLQQLK RKNHQIWRPQ 120 RGLPEKSVSV LRTWMFQNFL HPYPKDSEKH LLAIRSGLTR SQVSNWFINA RVRLWKPMIE 180 DMYAEMNKRK LSNTPLQGGN GGSFIRVPKS VMMSQERDKI RE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3k2a_A | 3e-14 | 123 | 180 | 5 | 62 | Homeobox protein Meis2 |
3k2a_B | 3e-14 | 123 | 180 | 5 | 62 | Homeobox protein Meis2 |
4xrm_A | 3e-14 | 123 | 180 | 5 | 62 | Homeobox protein Meis2 |
4xrm_B | 3e-14 | 123 | 180 | 5 | 62 | Homeobox protein Meis2 |
5bng_A | 3e-14 | 123 | 180 | 1 | 58 | Homeobox protein Meis2 |
5bng_B | 3e-14 | 123 | 180 | 1 | 58 | Homeobox protein Meis2 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Down-regulated in the shoot apical meristem (SAM) upon floral induction. {ECO:0000269|PubMed:17908157}. | |||||
Uniprot | TISSUE SPECIFICITY: Most abundant in flowers. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor which may be involved in the signal transduction pathway downstream of the COP1 gene. Controls floral competency as a specific activator of FLC expression. Is responsive of the nuclear import of SHOOT MERISTEMLESS (STM). {ECO:0000269|PubMed:17908157}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00121181001 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By light. In etiolated seedlings, maximally expressed after 3 days of illumination. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY072174 | 0.0 | AY072174.1 Arabidopsis thaliana putative homeobox gene ATH1 protein (At4g32980) mRNA, complete cds. | |||
GenBank | AY096513 | 0.0 | AY096513.1 Arabidopsis thaliana putative homeobox gene ATH1 protein (At4g32980) mRNA, complete cds. | |||
GenBank | X80126 | 0.0 | X80126.1 A.thaliana AtH1 mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009125187.1 | 1e-155 | PREDICTED: homeobox protein ATH1 | ||||
Refseq | XP_009125194.1 | 1e-155 | PREDICTED: homeobox protein ATH1 | ||||
Refseq | XP_022551501.1 | 1e-155 | homeobox protein ATH1-like | ||||
Swissprot | P48731 | 1e-132 | ATH1_ARATH; Homeobox protein ATH1 | ||||
TrEMBL | A0A3P5ZMB2 | 1e-154 | A0A3P5ZMB2_BRACM; Uncharacterized protein | ||||
TrEMBL | M4D4J9 | 1e-154 | M4D4J9_BRARP; Uncharacterized protein | ||||
STRING | Bra011403.1-P | 1e-155 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM8228 | 26 | 37 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G32980.1 | 1e-134 | homeobox gene 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|