PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00118568001
Common NameGSBRNA2T00118568001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 93aa    MW: 10572.4 Da    PI: 10.7476
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00118568001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF53.92.2e-17957151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         k+ien   rqvtfskRrn ++KKA+ELS LC+++   i+fs+t k+y +ss
  GSBRNA2T00118568001  9 KKIENVNSRQVTFSKRRNRLIKKANELSFLCEVD--KIVFSNTVKVYYFSS 57
                         68*****************************766..699********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.4E-23158IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.114159IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.27E-21268IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-14323IPR002100Transcription factor, MADS-box
PfamPF003195.2E-171055IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-142338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 93 aa     Download sequence    Send to blast
MGRGKIEIKK IENVNSRQVT FSKRRNRLIK KANELSFLCE VDKIVFSNTV KVYYFSSGRA  60
VLSTIDRVDG EVFVLGFVFK DSRLCLRGFG FV*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.271413e-41seed
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: During the reproductive phase, accumulates in immature buds and at the base of the floral organs, and in the receptacle, ovules, anther filaments, and stigma and style of open flowers. Later observed in sporogenous tissue of anthers. During male gametogenesis, expressed in the microspores before they separate from each other. Later present at high levels within pollen grains up to stage 13 of flower development, when anthers dehisce. During carpel development, first detected in developing ovules. After fertilization, confined to globular structures or nodules of proliferating free nuclear endosperm required for embryo development. Disappears from the endosperm at to the heart stage of embryo development, when very little nuclear endosperm remains. Never detected in developing embryos at any stage. In young seedlings, present everywhere except in a portion of the hypocotyl and in newly emerging leaves. {ECO:0000269|PubMed:11115127, ECO:0000269|PubMed:17521410}.
UniprotTISSUE SPECIFICITY: Mostly expressed in pollen, roots, flowers and siliques, and to a lower extent, in stems and leaves. Expressed in the endosperm and in developing male and female gametophytes. Also present in seedlings. {ECO:0000269|PubMed:11115127, ECO:0000269|PubMed:12837945, ECO:0000269|PubMed:12949148, ECO:0000269|PubMed:16028119, ECO:0000269|PubMed:17521410}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the negative regulation of flowering, probably through the photoperiodic pathway. Prevents premature flowering. Downstream regulator of a subset of the MIKC* MADS-controlled genes required during pollen maturation. {ECO:0000269|PubMed:17521410, ECO:0000269|PubMed:18034896, ECO:0000269|PubMed:18799658}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00118568001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018509174.16e-32PREDICTED: mitochondrial inner membrane protein OXA1-like
SwissprotQ9M2K87e-21AGL18_ARATH; Agamous-like MADS-box protein AGL18
TrEMBLA0A3P6A5C12e-57A0A3P6A5C1_BRACM; Uncharacterized protein
STRINGBo7g003640.15e-43(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57390.13e-23AGAMOUS-like 18
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]