PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00102739001
Common NameGSBRNA2T00102739001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 283aa    MW: 32471.8 Da    PI: 6.4124
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00102739001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK78.66.8e-25117167252
               RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          +k +s+e++s+yF++pi++AA eL+v+lT+LKr+CR++G +RWPhRk+ sl
  GSBRNA2T00102739001 117 SKALSMETISRYFYMPITQAAMELDVGLTLLKRRCRELGFRRWPHRKLMSL 167
                          689*********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.608102187IPR003035RWP-RK domain
PfamPF020427.4E-20120167IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MVDHKLKEDK PFSFLTYSPS FDDHIRSALT FPSFDWEEEL LPLHNNFVSQ AFHLPTPSLS  60
LPDLEPLSQD VLDSYSSAEQ NRGEDDLDMN TKKRRLNREH NVRIISDVTT YTTFPASKAL  120
SMETISRYFY MPITQAAMEL DVGLTLLKRR CRELGFRRWP HRKLMSLLAL ISNVKERQKM  180
QGGEKAGIFK NAVEILEDER RRIEENPDLE FSDKTKRLRQ ACFKATHKMK KKNSLKSSEM  240
SKPSCSSSGS VLSEEESVIE GVESDEEVKY LLCGFTNEFS GL*
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00234DAPTransfer from AT1G74480Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00102739001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895741e-162AC189574.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH011B08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009106115.10.0PREDICTED: protein RKD2
RefseqXP_013649774.10.0protein RKD2-like
RefseqXP_013701812.10.0protein RKD2-like
SwissprotQ9CA661e-111RKD2_ARATH; Protein RKD2
TrEMBLM4DHD00.0M4DHD0_BRARP; Uncharacterized protein
STRINGBra015907.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM39662356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74480.12e-88RWP-RK domain-containing protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  2. Tedeschi F,Rizzo P,Rutten T,Altschmied L,Bäumlein H
    RWP-RK domain-containing transcription factors control cell differentiation during female gametophyte development in Arabidopsis.
    New Phytol., 2017. 213(4): p. 1909-1924
    [PMID:27870062]