| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | GRAS | 35.6 | 1.3e-11 | 86 | 140 | 1 | 55 |
GRAS 1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar 55
lv+ L++cAea+++++++ a+al++++ la +++ +m+++a+yf++ L + ++r
GSBRNA2T00090973001 86 LVHSLMACAEAIKNSKFTIAEALVKQIGFLAVSQAGAMRKVATYFANTLVRWIYR 140
689***********************************************99988 PP
|
| Publications
? help Back to Top |
- Duarte JM, et al.
Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
Mol. Biol. Evol., 2006. 23(2): p. 469-78
[PMID:16280546] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
BMC Plant Biol., 2013. 13: p. 229
[PMID:24377444] - Gallego-Giraldo C, et al.
Role of the gibberellin receptors GID1 during fruit-set in Arabidopsis.
Plant J., 2014. 79(6): p. 1020-1032
[PMID:24961590] - Fukazawa J, et al.
DELLAs function as coactivators of GAI-ASSOCIATED FACTOR1 in regulation of gibberellin homeostasis and signaling in Arabidopsis.
Plant Cell, 2014. 26(7): p. 2920-38
[PMID:25035403] - Chalhoub B, et al.
Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
Science, 2014. 345(6199): p. 950-3
[PMID:25146293] - Marín-de la Rosa N, et al.
Genome Wide Binding Site Analysis Reveals Transcriptional Coactivation of Cytokinin-Responsive Genes by DELLA Proteins.
PLoS Genet., 2015. 11(7): p. e1005337
[PMID:26134422] - Shi H,Wei Y,Wang Q,Reiter RJ,He C
Melatonin mediates the stabilization of DELLA proteins to repress the floral transition in Arabidopsis.
J. Pineal Res., 2016. 60(3): p. 373-9
[PMID:26887824] - Lee SA, et al.
Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
Mol Plant, 2016. 9(6): p. 870-84
[PMID:26970019] - Qu J,Kang SG,Hah C,Jang JC
Molecular and cellular characterization of GA-Stimulated Transcripts GASA4 and GASA6 in Arabidopsis thaliana.
Plant Sci., 2016. 246: p. 1-10
[PMID:26993231] - Shahnejat-Bushehri S,Nobmann B,Devi Allu A,Balazadeh S
JUB1 suppresses Pseudomonas syringae-induced defense responses through accumulation of DELLA proteins.
Plant Signal Behav, 2016. 11(6): p. e1181245
[PMID:27159137] - Shahnejat-Bushehri S,Tarkowska D,Sakuraba Y,Balazadeh S
Arabidopsis NAC transcription factor JUB1 regulates GA/BR metabolism and signalling.
Nat Plants, 2016. 2: p. 16013
[PMID:27249348] - Wang H, et al.
The DELLA-CONSTANS Transcription Factor Cascade Integrates Gibberellic Acid and Photoperiod Signaling to Regulate Flowering.
Plant Physiol., 2016. 172(1): p. 479-88
[PMID:27406167] - Li W,Wang H,Yu D
Arabidopsis WRKY Transcription Factors WRKY12 and WRKY13 Oppositely Regulate Flowering under Short-Day Conditions.
Mol Plant, 2016. 9(11): p. 1492-1503
[PMID:27592586] - Liu B,De Storme N,Geelen D
Gibberellin Induces Diploid Pollen Formation by Interfering with Meiotic Cytokinesis.
Plant Physiol., 2017. 173(1): p. 338-353
[PMID:27621423] - Matsuoka K, et al.
Differential Cellular Control by Cotyledon-Derived Phytohormones Involved in Graft Reunion of Arabidopsis Hypocotyls.
Plant Cell Physiol., 2016. 57(12): p. 2620-2631
[PMID:27986917] - Zentella R, et al.
The Arabidopsis O-fucosyltransferase SPINDLY activates nuclear growth repressor DELLA.
Nat. Chem. Biol., 2017. 13(5): p. 479-485
[PMID:28244988] - Zhang Y, et al.
GA-DELLA pathway is involved in regulation of nitrogen deficiency-induced anthocyanin accumulation.
Plant Cell Rep., 2017. 36(4): p. 557-569
[PMID:28275852] - Zhang L,Chen L,Yu D
Transcription Factor WRKY75 Interacts with DELLA Proteins to Affect Flowering.
Plant Physiol., 2018. 176(1): p. 790-803
[PMID:29133369] - Nelson SK,Ariizumi T,Steber CM
Biology in the Dry Seed: Transcriptome Changes Associated with Dry Seed Dormancy and Dormancy Loss in the Arabidopsis GA-Insensitive sleepy1-2 Mutant.
Front Plant Sci, 2017. 8: p. 2158
[PMID:29312402] - Liu B,De Storme N,Geelen D
Cold-Induced Male Meiotic Restitution in Arabidopsis thaliana Is Not Mediated by GA-DELLA Signaling.
Front Plant Sci, 2018. 9: p. 91
[PMID:29459879] - Zhang Y, et al.
DELLA proteins negatively regulate dark-induced senescence and chlorophyll degradation in Arabidopsis through interaction with the transcription factor WRKY6.
Plant Cell Rep., 2018. 37(7): p. 981-992
[PMID:29574486] - Felipo-Benavent A, et al.
Regulation of xylem fiber differentiation by gibberellins through DELLA-KNAT1 interaction.
Development, 2019.
[PMID:30389856] - Wright DA, et al.
Recovery of YAC-end sequences through complementation of an Escherichia coli pyrF mutation.
Nucleic Acids Res., 1997. 25(13): p. 2679-80
[PMID:9185581]
|
