PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00080116001

Common Name

GSBRNA2T00080116001, LOC106371126

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

MYB

Protein Properties

Length: 327aa MW: 36487.5 Da PI: 8.7047

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00080116001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	54.4	2.9e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd +lv +++++G+g+W++++ g+ R+ k+c++rw +yl GSBRNA2T00080116001 14 KGPWTPEEDIILVTYIQEHGPGNWRAVPTNTGLLRCSKSCRLRWTNYL 61 79****************************99**********97 PP
2	Myb_DNA-binding	50.2	6.1e-16	67	112	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T+ E++ +v++ ++lG++ W++Ia++++ Rt++++k++w+++l GSBRNA2T00080116001 67 RGNFTEHEEKMIVHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112 89******************.*****.**********996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.4E-23	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	17.078	9	61	IPR017930	Myb domain
SuperFamily	SSF46689	1.91E-30	11	108	IPR009057	Homeodomain-like
SMART	SM00717	1.6E-14	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	5.7E-16	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	1.23E-10	16	61	No hit	No description
PROSITE profile	PS51294	23.739	62	116	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.5E-24	65	117	IPR009057	Homeodomain-like
SMART	SM00717	2.5E-15	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	3.2E-14	67	112	IPR001005	SANT/Myb domain
CDD	cd00167	3.63E-10	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 327 aa Download sequence Send to blast
MVRPPCCDKG GVKKGPWTPE EDIILVTYIQ EHGPGNWRAV PTNTGLLRCS KSCRLRWTNY 60 LRPGIKRGNF TEHEEKMIVH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLNKAN 120 QVSHQEHDQS RDRSSLSSSP SSSSANSNSN IARGQWERRL QTDIHLAKKA LSEALSPAVA 180 PINTATTSSS TESRRSTSSA SGFLRTQETS TTYASNTENI AKLLKGWVKK SPTQNSADQM 240 VSPDSETKEV IKSNVEKDCA WAFQSFSGFD HLKDRDSAGV SPDHETKPDI TGYSNQSQWS 300 LFEKWLFEDS GGQVGDILLD ENPNFF*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	3e-25	14	116	4	105	MYB PROTO-ONCOGENE PROTEIN
1h88_C	1e-24	14	116	58	159	MYB PROTO-ONCOGENE PROTEIN
1h89_C	1e-24	14	116	58	159	MYB PROTO-ONCOGENE PROTEIN
1h8a_C	5e-25	12	116	25	128	MYB TRANSFORMING PROTEIN
1mse_C	3e-25	14	116	4	105	C-Myb DNA-Binding Domain
1msf_C	3e-25	14	116	4	105	C-Myb DNA-Binding Domain
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed in 2-week-old seedlings, in the early stages of development. {ECO:0000269\|PubMed:10571865}.
Uniprot	TISSUE SPECIFICITY: Expressed in vascular tissues of leaves, hypocotyl and roots. {ECO:0000269\|PubMed:24587042}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to the DNA sequence 5'-AACAAAC-3' (PubMed:19170933). Acts as a positive regulator of hypersensitive cell death (PubMed:10571865, PubMed:12119395). Acts as a positive regulator of salicylic acid synthesis (PubMed:16730712). Regulates very-long-chain fatty acid biosynthesis (PubMed:18326828). Acts cooperatively with BZR2 to promote expression of a subset of brassinosteroids target genes (PubMed:19170933). Transcriptional activity and hypersensitive response control negatively regulated by PLA2-ALPHA and by the Xanthomonas type III effector XopD (AC G9L9K6) (PubMed:20696912, PubMed:21917550). Involved in the regulation of abscisic acid (ABA) signaling (PubMed:22814374). Increased levels of MYB30 can accelerate flowering both in long and short days through the regulation of FT (PubMed:24587042). {ECO:0000269\|PubMed:10571865, ECO:0000269\|PubMed:12119395, ECO:0000269\|PubMed:16730712, ECO:0000269\|PubMed:18326828, ECO:0000269\|PubMed:19170933, ECO:0000269\|PubMed:20696912, ECO:0000269\|PubMed:21917550, ECO:0000269\|PubMed:22814374, ECO:0000269\|PubMed:24587042}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00080116001

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated during hypersensitive response, but no expression detected during compatible interaction with pathogens (PubMed:10571865). Specifically induced in the inoculated zone 4 hours post pathogen infection (PubMed:20696912). Up-regulated by jasmonic acid and salicylic acid (PubMed:16463103, PubMed:16730712). Transcriptionally regulated by BZR2 (PubMed:19170933). {ECO:0000269\|PubMed:10571865, ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:16730712, ECO:0000269\|PubMed:19170933, ECO:0000269\|PubMed:20696912}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KC966735	0.0	KC966735.1 Brassica napus MYB transcription factor 30 (MYB30.1) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013666620.1	0.0	transcription factor MYB30
Swissprot	Q9SCU7	0.0	MYB30_ARATH; Transcription factor MYB30
TrEMBL	A0A078I5L0	0.0	A0A078I5L0_BRANA; BnaA02g29490D protein
STRING	Bra033067.1-P	0.0	(Brassica rapa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM5842	23	48

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28910.1	1e-179	myb domain protein 30

Link Out ? help Back to Top
Entrez Gene	106371126

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Kaurilind E,Xu E,Brosché M A genetic framework for H2O2 induced cell death in Arabidopsis thaliana. BMC Genomics, 2015. 16: p. 837 [PMID:26493993] Lee HG,Seo PJ The Arabidopsis MIEL1 E3 ligase negatively regulates ABA signalling by promoting protein turnover of MYB96. Nat Commun, 2016. 7: p. 12525 [PMID:27615387] Serrano I, et al. A non canonical subtilase attenuates the transcriptional activation of defence responses in Arabidopsis thaliana. Elife, 2017. [PMID:27685353] Liao C,Zheng Y,Guo Y MYB30 transcription factor regulates oxidative and heat stress responses through ANNEXIN-mediated cytosolic calcium signaling in Arabidopsis. New Phytol., 2017. 216(1): p. 163-177 [PMID:28726305] Lee HG,Kim J,Suh MC,Seo PJ The MIEL1 E3 Ubiquitin Ligase Negatively Regulates Cuticular Wax Biosynthesis in Arabidopsis Stems. Plant Cell Physiol., 2017. 58(7): p. 1249-1259 [PMID:28838126] Mabuchi K, et al. MYB30 links ROS signaling, root cell elongation, and plant immune responses. Proc. Natl. Acad. Sci. U.S.A., 2018. 115(20): p. E4710-E4719 [PMID:29712840] Zheng Y,Chen Z,Ma L,Liao C The Ubiquitin E3 Ligase RHA2b Promotes Degradation of MYB30 in Abscisic Acid Signaling. Plant Physiol., 2018. 178(1): p. 428-440 [PMID:30030326]