PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00068959001 | ||||||||
Common Name | GSBRNA2T00068959001, LOC106363908 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 164aa MW: 18034.7 Da PI: 8.1321 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 144.1 | 4.2e-45 | 13 | 112 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 +CaaCk+lrrkC++dCv+apyfpa++p kfa+vhk+FGasnv+k+l+ l+e++r+da++s+vyeA+ar++dPvyG+vg+i++lq+qle+l GSBRNA2T00068959001 13 PCAACKLLRRKCVEDCVFAPYFPAKEPYKFAIVHKIFGASNVSKMLQVLSENHRSDAVNSIVYEANARVQDPVYGCVGIISSLQRQLETL 102 7***************************************************************************************** PP DUF260 91 kaelallkee 100 +++la +++e GSBRNA2T00068959001 103 QTQLAFAQAE 112 *****99987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 26.596 | 12 | 113 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 2.3E-43 | 13 | 110 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 164 aa Download sequence Send to blast |
MRRNGHSHGA VSPCAACKLL RRKCVEDCVF APYFPAKEPY KFAIVHKIFG ASNVSKMLQV 60 LSENHRSDAV NSIVYEANAR VQDPVYGCVG IISSLQRQLE TLQTQLAFAQ AELVHMKTLH 120 RIDTKPPPYM ASGISFPANK DLSNDVDMAF AYENGAGESL WSC* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 9e-45 | 9 | 114 | 7 | 112 | LOB family transfactor Ramosa2.1 |
5ly0_B | 9e-45 | 9 | 114 | 7 | 112 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. At the bases of lateral organs formed from vegetative, inflorescence, and floral meristems. {ECO:0000269|PubMed:12068116, ECO:0000269|PubMed:17485849}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00068959001 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By cytokinin. {ECO:0000269|PubMed:17485849}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013659026.1 | 1e-121 | LOB domain-containing protein 3 | ||||
Swissprot | Q9SA51 | 4e-97 | LBD3_ARATH; LOB domain-containing protein 3 | ||||
TrEMBL | A0A078HS02 | 1e-120 | A0A078HS02_BRANA; BnaC05g12610D protein | ||||
TrEMBL | A0A3N6QCN1 | 1e-120 | A0A3N6QCN1_BRACR; Uncharacterized protein | ||||
TrEMBL | A0A3P6FEE1 | 1e-120 | A0A3P6FEE1_BRAOL; Uncharacterized protein | ||||
STRING | Bo5g021980.1 | 1e-120 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM131 | 28 | 340 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G16530.1 | 3e-89 | ASYMMETRIC LEAVES 2-like 9 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 106363908 |
Publications ? help Back to Top | |||
---|---|---|---|
|