PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00055766001 | ||||||||
Common Name | GSBRNA2T00055766001, LOC106346763 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 164aa MW: 18075.8 Da PI: 8.3718 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 143.2 | 7.8e-45 | 13 | 112 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 +CaaCk+lrrkC++dCv+apyfpa++p kfa+vhk+FGasnv k+l+ l+e++r+da++s+vyeA+ar++dPvyG+vg+i++lq+qle+l GSBRNA2T00055766001 13 PCAACKLLRRKCVEDCVFAPYFPAKEPYKFAIVHKIFGASNVNKMLQVLSENHRSDAVNSIVYEANARVQDPVYGCVGIISSLQRQLETL 102 7***************************************************************************************** PP DUF260 91 kaelallkee 100 +++la +++e GSBRNA2T00055766001 103 QTQLAFAQAE 112 *****99987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 26.493 | 12 | 113 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 4.1E-43 | 13 | 110 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 164 aa Download sequence Send to blast |
MRRKGHSHGA VSPCAACKLL RRKCVEDCVF APYFPAKEPY KFAIVHKIFG ASNVNKMLQV 60 LSENHRSDAV NSIVYEANAR VQDPVYGCVG IISSLQRQLE TLQTQLAFAQ AELVHMKTLH 120 RIDTKPPPYM ASGISFPANK DLSNDVDMAF AYENGAGESL WSC* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 1e-44 | 9 | 114 | 7 | 112 | LOB family transfactor Ramosa2.1 |
5ly0_B | 1e-44 | 9 | 114 | 7 | 112 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. At the bases of lateral organs formed from vegetative, inflorescence, and floral meristems. {ECO:0000269|PubMed:12068116, ECO:0000269|PubMed:17485849}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00055766001 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By cytokinin. {ECO:0000269|PubMed:17485849}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009149087.1 | 1e-121 | PREDICTED: LOB domain-containing protein 3 | ||||
Refseq | XP_013641646.1 | 1e-121 | LOB domain-containing protein 3 | ||||
Swissprot | Q9SA51 | 1e-98 | LBD3_ARATH; LOB domain-containing protein 3 | ||||
TrEMBL | A0A078JJD7 | 1e-120 | A0A078JJD7_BRANA; BnaA06g38340D protein | ||||
TrEMBL | A0A291LQZ1 | 1e-120 | A0A291LQZ1_BRARR; Transcription factor LBD3 | ||||
TrEMBL | A0A397Z3B7 | 1e-120 | A0A397Z3B7_BRACM; Uncharacterized protein | ||||
TrEMBL | M4EB83 | 1e-120 | M4EB83_BRARP; Uncharacterized protein | ||||
STRING | Bra026042.1-P | 1e-121 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM131 | 28 | 340 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G16530.1 | 1e-90 | ASYMMETRIC LEAVES 2-like 9 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 106346763 |
Publications ? help Back to Top | |||
---|---|---|---|
|