PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00047230001

Common Name

GSBRNA2T00047230001, LOC106360280

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

YABBY

Protein Properties

Length: 159aa MW: 17927.2 Da PI: 10.5495

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00047230001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	193.5	9.6e-60	1	134	31	170
YABBY 31 lfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsseklsenedeevprvppvirPPe 120 +f++vtvrCGhCt+lls+n+ ++ ++ + + +++l++++++ +++++ ++ ++s s+++ s++lsen d+e+pr+pp irPPe GSBRNA2T00047230001 1 MFTLVTVRCGHCTNLLSLNIGVSLHQSPPTPI-----HQDLQQHKQQITTSITRKEYGSSSRSSNHFSTTLSENVDREAPRMPP-IRPPE 84 699******************999998873.....4455555555556666666666666666666678*******99.9 PP YABBY 121 krqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 krqrvPsaynrfikeeiqrika+nP+ishreafs+aaknWahfP+ihfgl GSBRNA2T00047230001 85 KRQRVPSAYNRFIKEEIQRIKAGNPEISHREAFSTAAKNWAHFPHIHFGL 134 **********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	8.2E-56	1	134	IPR006780	YABBY protein
SuperFamily	SSF47095	7.99E-8	79	127	IPR009071	High mobility group box domain
Gene3D	G3DSA:1.10.30.10	8.8E-5	82	128	IPR009071	High mobility group box domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0007275	Biological Process	multicellular organism development

Sequence ? help Back to Top
Protein Sequence Length: 159 aa Download sequence Send to blast
MFTLVTVRCG HCTNLLSLNI GVSLHQSPPT PIHQDLQQHK QQITTSITRK EYGSSSRSSN 60 HFSTTLSENV DREAPRMPPI RPPEKRQRVP SAYNRFIKEE IQRIKAGNPE ISHREAFSTA 120 AKNWAHFPHI HFGLKLDGNK KGKQLDQTVA GQKSNGYY*

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed in subepidermal cells of anlagen regions, then in abaxial part of primordia and finally in differentiating organs. Levels decrease in differentiated organs. In embryo, expressed from the heart stage in the abaxial domain of the cotyledon primordia and decrease as the embryo matures. In stamen, expression restricted to the abaxial region differentiating into the connective. In gynoecium, expressed in the abaxial cell layers differentiating into the valves. {ECO:0000269\|PubMed:10457020}.
Uniprot	TISSUE SPECIFICITY: Expressed at low levels in abaxial regions of lateral aerial organ primordia leading to cotyledons, leaves, flower meristems, sepals, petals, stamen and carpels, but not in roots. {ECO:0000269\|PubMed:10457020}.

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the abaxial cell fate determination during embryogenesis and organogenesis. {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00047230001

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK353326	0.0	AK353326.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-29-D23.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009110891.1	1e-116	PREDICTED: putative axial regulator YABBY 2 isoform X1
Refseq	XP_013655318.1	1e-116	putative axial regulator YABBY 2 isoform X1
Refseq	XP_013657611.1	1e-116	putative axial regulator YABBY 2 isoform X1
Swissprot	Q9XFB0	2e-97	YAB2_ARATH; Putative axial regulator YABBY 2
TrEMBL	A0A078H0Y7	1e-115	A0A078H0Y7_BRANA; BnaA08g26920D protein
TrEMBL	A0A397YFU6	1e-115	A0A397YFU6_BRACM; Uncharacterized protein
STRING	Bra030728.1-P	1e-109	(Brassica rapa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM5581	27	49

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G08465.1	4e-93	YABBY family protein

Link Out ? help Back to Top
Entrez Gene	106360280

Publications ? help Back to Top
Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Sacharowski SP, et al. SWP73 Subunits of Arabidopsis SWI/SNF Chromatin Remodeling Complexes Play Distinct Roles in Leaf and Flower Development. Plant Cell, 2015. 27(7): p. 1889-906 [PMID:26106148]