PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00046205001 | ||||||||
Common Name | GSBRNA2T00046205001, LOC106356512 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 296aa MW: 34146.5 Da PI: 6.0797 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 173 | 8.9e-54 | 12 | 138 | 2 | 127 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 ppGfrFhPtdeelv +yLkkkv++++++l +vi+e+d+yk+ePwdL++ ++e+kewyfFs++dkky+tg+r+nrat +g+Wkatg+ GSBRNA2T00046205001 12 PPGFRFHPTDEELVGYYLKKKVASQSIDL-DVIREIDLYKIEPWDLQErcrIGYEEQKEWYFFSHKDKKYPTGTRTNRATMAGFWKATGR 100 9****************************.9***************953432234677******************************** PP NAM 89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127 dk+v+ +++l+g++ktLvfy+grap+g+k+dW++hey GSBRNA2T00046205001 101 DKAVYL-NSKLIGMRKTLVFYRGRAPNGQKSDWIIHEYY 138 ******.999***************************95 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.7E-59 | 7 | 162 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 57.406 | 11 | 162 | IPR003441 | NAC domain |
Pfam | PF02365 | 9.7E-27 | 12 | 137 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048759 | Biological Process | xylem vessel member cell differentiation | ||||
GO:1901348 | Biological Process | positive regulation of secondary cell wall biogenesis | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 296 aa Download sequence Send to blast |
MMGPVDQESS IPPGFRFHPT DEELVGYYLK KKVASQSIDL DVIREIDLYK IEPWDLQERC 60 RIGYEEQKEW YFFSHKDKKY PTGTRTNRAT MAGFWKATGR DKAVYLNSKL IGMRKTLVFY 120 RGRAPNGQKS DWIIHEYYSL ESHQNAPQQQ EEGWVVCRAF KKRTTVPTKR RQIWDSNCFL 180 YDDATLLEPL DKNVLIKRAK HNTDGLAVTP FKQELPSEAN QIVDDGFFGS MYLKSMGDDE 240 LSQLPQLESP SLASDKLPET TSRTGEDDVG AEKRMTDWRA LDKFVASQFL MNGEE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 4e-50 | 10 | 166 | 16 | 169 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 4e-50 | 10 | 166 | 16 | 169 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 4e-50 | 10 | 166 | 16 | 169 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 4e-50 | 10 | 166 | 16 | 169 | NO APICAL MERISTEM PROTEIN |
3swm_A | 4e-50 | 10 | 166 | 19 | 172 | NAC domain-containing protein 19 |
3swm_B | 4e-50 | 10 | 166 | 19 | 172 | NAC domain-containing protein 19 |
3swm_C | 4e-50 | 10 | 166 | 19 | 172 | NAC domain-containing protein 19 |
3swm_D | 4e-50 | 10 | 166 | 19 | 172 | NAC domain-containing protein 19 |
3swp_A | 4e-50 | 10 | 166 | 19 | 172 | NAC domain-containing protein 19 |
3swp_B | 4e-50 | 10 | 166 | 19 | 172 | NAC domain-containing protein 19 |
3swp_C | 4e-50 | 10 | 166 | 19 | 172 | NAC domain-containing protein 19 |
3swp_D | 4e-50 | 10 | 166 | 19 | 172 | NAC domain-containing protein 19 |
4dul_A | 4e-50 | 10 | 166 | 16 | 169 | NAC domain-containing protein 19 |
4dul_B | 4e-50 | 10 | 166 | 16 | 169 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Up-regulated during xylem vessel element formation. Expressed preferentially in procambial cells adjacent to root meristem. {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}. | |||||
Uniprot | TISSUE SPECIFICITY: Detected in root protoxylem and metaxylem poles and in vessels of protoxylems, outermost metaxylems, inner metaxylems, shoots and hypocotyls. Expressed in roots, hypocotyls, cotyledons and leaves (PubMed:18445131). Present in developing xylems (PubMed:16103214, PubMed:17565617). Present in root developing xylems (PubMed:16103214). Specifically expressed in vessels but not in interfascicular fibers in stems (PubMed:25148240). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:17565617, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:25148240}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00590 | DAP | Transfer from AT5G66300 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00046205001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF738278 | 0.0 | KF738278.1 Brassica napus NAC transcription factor 105 (NAC105.1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013651709.1 | 0.0 | NAC domain-containing protein 105-like isoform X1 | ||||
Swissprot | Q9FH59 | 1e-170 | NC105_ARATH; NAC domain-containing protein 105 | ||||
TrEMBL | A0A078H1T9 | 0.0 | A0A078H1T9_BRANA; BnaC07g16780D protein | ||||
STRING | Bo7g065010.1 | 0.0 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM15134 | 16 | 19 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G66300.1 | 1e-160 | NAC domain containing protein 105 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 106356512 |
Publications ? help Back to Top | |||
---|---|---|---|
|