PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00041124001 | ||||||||
Common Name | GSBRNA2T00041124001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 193aa MW: 22237.7 Da PI: 10.7728 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 48.9 | 1.5e-15 | 68 | 124 | 3 | 59 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 ++kr+rr+ +NRe+ArrsR+RK++++ e + + +L +e ++L ++l+ ++ ++++ GSBRNA2T00041124001 68 DVKRARRMLSNRESARRSRRRKQEQMNEFDTQAGQLRGEHSTLLSRLSDMNHKCDAA 124 68*********************************************9999999865 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 1.7E-10 | 65 | 122 | No hit | No description |
SMART | SM00338 | 2.3E-15 | 66 | 130 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.289 | 68 | 120 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 6.3E-13 | 69 | 122 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 3.7E-10 | 70 | 119 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 73 | 88 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 193 aa Download sequence Send to blast |
MVFTASTHLK FFPINPFILS NLVHFSTFIL LGSVVAQTSP GKLPVFHHAM ILMTMILMET 60 QINGDPTDVK RARRMLSNRE SARRSRRRKQ EQMNEFDTQA GQLRGEHSTL LSRLSDMNHK 120 CDAAAVDNRI LRADIETLRT KIMILTKFMN PTDQRVERAN LLPEQVNREG MQNQFATNPN 180 LYETLLHWNH KH* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 82 | 89 | RRSRRRKQ |
2 | 84 | 89 | SRRRKQ |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Bna.21111 | 1e-69 | leaf |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: First observed in seeds at early stages of development, mostly in embryo and, at lower extent, in the endosperm. Accumulates and peaks at maturation. Fade out during late seed development steps, restricted to the inner layer of the seed coat, and, at very low levels, in the mature embryo and the remaining endosperm. Also present in the lignified inner subepidermal layer of the valves. {ECO:0000269|PubMed:12657652, ECO:0000269|PubMed:18841482}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, shoots, stems, leaves, stipulae, siliques, seeds, pollen, and flowers. {ECO:0000269|PubMed:12657652, ECO:0000269|PubMed:18841482}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to the 5'-ACGT-3' box, especially present in G-box-like motif (5'-CCACGTGGCC-3'), ABRE elements, of seed storage protein (SSP) encoding gene promoters (e.g. At2S and CRU3) and promotes their expression in seeds when in complex with ABI3 and BZIP53. {ECO:0000269|PubMed:12657652, ECO:0000269|PubMed:19261733, ECO:0000269|PubMed:19531597}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00041124001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY057509 | 1e-121 | AY057509.1 Arabidopsis thaliana bZIP transcription factor-like protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009139366.1 | 9e-63 | PREDICTED: basic leucine zipper 25-like, partial | ||||
Swissprot | Q9M1G6 | 7e-50 | BZP25_ARATH; Basic leucine zipper 25 | ||||
TrEMBL | A0A078JDG1 | 1e-141 | A0A078JDG1_BRANA; BnaA04g27730D protein | ||||
STRING | Bra014802.1-P | 7e-61 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM5848 | 26 | 45 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G54620.1 | 2e-52 | basic leucine zipper 25 |
Publications ? help Back to Top | |||
---|---|---|---|
|