| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | bZIP_1 | 47.5 | 3.9e-15 | 229 | 283 | 3 | 57 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57
++kr+rr+ +NRe+ArrsR+RK++++ e + v +L ae ++L+++l+ ++ +++
AT3G54620.1 229 DVKRARRMLSNRESARRSRRRKQEQMNEFDTQVGQLRAEHSTLINRLSDMNHKYD 283
68******************************************77776666655 PP
|
| Expression --
Description ? help
Back to Top |
| Source |
Description |
| Uniprot | DEVELOPMENTAL STAGE: First observed in seeds at early stages of development, mostly in embryo and, at lower extent, in the endosperm. Accumulates and peaks at maturation. Fade out during late seed development steps, restricted to the inner layer of the seed coat, and, at very low levels, in the mature embryo and the remaining endosperm. Also present in the lignified inner subepidermal layer of the valves. {ECO:0000269|PubMed:12657652, ECO:0000269|PubMed:18841482}. |
| Uniprot | TISSUE SPECIFICITY: Expressed in roots, shoots, stems, leaves, stipulae, siliques, seeds, pollen, and flowers. {ECO:0000269|PubMed:12657652, ECO:0000269|PubMed:18841482}. |
| Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
Science, 2000. 290(5499): p. 2105-10
[PMID:11118137] - Jakoby M, et al.
bZIP transcription factors in Arabidopsis.
Trends Plant Sci., 2002. 7(3): p. 106-11
[PMID:11906833] - Vincentz M,Bandeira-Kobarg C,Gauer L,Schl
Evolutionary pattern of angiosperm bZIP factors homologous to the maize Opaque2 regulatory protein.
J. Mol. Evol., 2003. 56(1): p. 105-16
[PMID:12569427] - Lara P, et al.
Synergistic activation of seed storage protein gene expression in Arabidopsis by ABI3 and two bZIPs related to OPAQUE2.
J. Biol. Chem., 2003. 278(23): p. 21003-11
[PMID:12657652] - Dal Bosco C, et al.
Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
J. Biol. Chem., 2004. 279(2): p. 1060-9
[PMID:14576160] - Yamada K, et al.
Empirical analysis of transcriptional activity in the Arabidopsis genome.
Science, 2003. 302(5646): p. 842-6
[PMID:14593172] - Satoh R,Fujita Y,Nakashima K,Shinozaki K,Yamaguchi-Shinozaki K
A novel subgroup of bZIP proteins functions as transcriptional activators in hypoosmolarity-responsive expression of the ProDH gene in Arabidopsis.
Plant Cell Physiol., 2004. 45(3): p. 309-17
[PMID:15047879] - Deppmann CD, et al.
Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs.
Nucleic Acids Res., 2004. 32(11): p. 3435-45
[PMID:15226410] - Ehlert A, et al.
Two-hybrid protein-protein interaction analysis in Arabidopsis protoplasts: establishment of a heterodimerization map of group C and group S bZIP transcription factors.
Plant J., 2006. 46(5): p. 890-900
[PMID:16709202] - Deppmann CD,Alvania RS,Taparowsky EJ
Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks.
Mol. Biol. Evol., 2006. 23(8): p. 1480-92
[PMID:16731568] - Weltmeier F, et al.
Combinatorial control of Arabidopsis proline dehydrogenase transcription by specific heterodimerisation of bZIP transcription factors.
EMBO J., 2006. 25(13): p. 3133-43
[PMID:16810321] - Cheng C, et al.
An early response regulatory cluster induced by low temperature and hydrogen peroxide in seedlings of chilling-tolerant japonica rice.
BMC Genomics, 2007. 8: p. 175
[PMID:17577400] - Ascencio-Ib
Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
Plant Physiol., 2008. 148(1): p. 436-54
[PMID:18650403] - Wang Y, et al.
Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
Plant Physiol., 2008. 148(3): p. 1201-11
[PMID:18775970] - Weltmeier F, et al.
Expression patterns within the Arabidopsis C/S1 bZIP transcription factor network: availability of heterodimerization partners controls gene expression during stress response and development.
Plant Mol. Biol., 2009. 69(1-2): p. 107-19
[PMID:18841482] - Jones AM, et al.
Phosphoproteomic analysis of nuclei-enriched fractions from Arabidopsis thaliana.
J Proteomics, 2009. 72(3): p. 439-51
[PMID:19245862] - Roschzttardtz H, et al.
A nuclear gene encoding the iron-sulfur subunit of mitochondrial complex II is regulated by B3 domain transcription factors during seed development in Arabidopsis.
Plant Physiol., 2009. 150(1): p. 84-95
[PMID:19261733] - Reiland S, et al.
Large-scale Arabidopsis phosphoproteome profiling reveals novel chloroplast kinase substrates and phosphorylation networks.
Plant Physiol., 2009. 150(2): p. 889-903
[PMID:19376835] - Alonso R, et al.
A pivotal role of the basic leucine zipper transcription factor bZIP53 in the regulation of Arabidopsis seed maturation gene expression based on heterodimerization and protein complex formation.
Plant Cell, 2009. 21(6): p. 1747-61
[PMID:19531597] - Kang SG,Price J,Lin PC,Hong JC,Jang JC
The arabidopsis bZIP1 transcription factor is involved in sugar signaling, protein networking, and DNA binding.
Mol Plant, 2010. 3(2): p. 361-73
[PMID:20080816] - Hanada K, et al.
Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
Mol. Biol. Evol., 2011. 28(1): p. 377-82
[PMID:20736450] - Song QX, et al.
Soybean GmbZIP123 gene enhances lipid content in the seeds of transgenic Arabidopsis plants.
J. Exp. Bot., 2013. 64(14): p. 4329-41
[PMID:23963672] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
BMC Plant Biol., 2013. 13: p. 229
[PMID:24377444] - Jin J, et al.
An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
Mol. Biol. Evol., 2015. 32(7): p. 1767-73
[PMID:25750178] - Ezer D, et al.
The G-Box Transcriptional Regulatory Code in Arabidopsis.
Plant Physiol., 2017. 175(2): p. 628-640
[PMID:28864470] - Jain P, et al.
A-ZIP53, a dominant negative reveals the molecular mechanism of heterodimerization between bZIP53, bZIP10 and bZIP25 involved in Arabidopsis seed maturation.
Sci Rep, 2017. 7(1): p. 14343
[PMID:29084982] - Pedrotti L, et al.
Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
Plant Cell, 2018. 30(2): p. 495-509
[PMID:29348240]
|
