PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00040729001

Common Name

GSBRNA2T00040729001

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

G2-like

Protein Properties

Length: 306aa MW: 34723.1 Da PI: 10.4033

Description

G2-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00040729001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	102.4	2.8e-32	209	262	2	55
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+ GSBRNA2T00040729001 209 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 262 9****************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	1.45E-15	206	262	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	7.9E-29	207	262	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	6.0E-24	209	262	IPR006447	Myb domain, plants
Pfam	PF00249	3.8E-7	210	261	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 306 aa Download sequence Send to blast
MEGVFLEKPK SNTTLPDLSL NISLPDITSK EHYRRPSQTD NNRSSNFELS LSHHHNPSSN 60 PTTRIIHCPD PRNLNLPHHQ HYNNPILNGG SLHQRVNESD INNIHRPIRG IPVYQNRSFP 120 FHQQTSLPSL GGGGDLDQIS ILNSSSGYNN AYRSLQSSPR LRGVPLHHHH HHNHYGVVGS 180 TDSSSPHHHG MIRSRFLPKM PTKRSMRAPR MRWTSSLHAR FVHAVELLGG HERATPKSVL 240 ELMDVKDLTL AHVKSHLQMY RTVKTTNKPA ASSGMCNSEQ LDLTLHTYTH RMFTFFRIAF 300 QLYIC*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6j4k_A	2e-16	210	264	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B	2e-16	210	264	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A	2e-16	210	264	3	57	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B	2e-16	210	264	3	57	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C	2e-16	210	264	3	57	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D	2e-16	210	264	3	57	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A	2e-16	210	264	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C	2e-16	210	264	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D	2e-16	210	264	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F	2e-16	210	264	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H	2e-16	210	264	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J	2e-16	210	264	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: In globular embryos, expressed in the peripheral cells in a basal region above the hypophysis. In heart-stage embryos, expressed in the periphery of the presumptive hypocotyl and on the abaxial side of cotyledon primordia. During vegetative growth, expressed the abaxial side of very young leaf primordia. Expressed on the abaxial side of carpel primordia and then in a localized region on the abaxial margin that gives rise to the septum. Later, expressed in the tissue that gives rise to ovules. {ECO:0000269\|PubMed:11525739}.
Uniprot	TISSUE SPECIFICITY: Expressed in developing phloem and lateral root. {ECO:0000269\|PubMed:11525739, ECO:0000269\|PubMed:14561401, ECO:0000269\|PubMed:15286295}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional repressor that regulates lateral organ polarity. Promotes lateral organ abaxial identity by repressing the adaxial regulator ASYMMETRIC LEAVES2 (AS2) in abaxial cells. Required for abaxial identity in both leaves and carpels. Functions with KAN2 in the specification of polarity of the ovule outer integument. Regulates cambium activity by repressing the auxin efflux carrier PIN1. Plays a role in lateral root formation and development. {ECO:0000269\|PubMed:11395775, ECO:0000269\|PubMed:11525739, ECO:0000269\|PubMed:14561401, ECO:0000269\|PubMed:15286295, ECO:0000269\|PubMed:16623911, ECO:0000269\|PubMed:17307928, ECO:0000269\|PubMed:18849474, ECO:0000269\|PubMed:20179097}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00040729001

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by AS2 in adaxial tissue. {ECO:0000269\|PubMed:18849474}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY030192	0.0	AY030192.1 Arabidopsis thaliana clone A1-2 KANADI protein (KAN) mRNA, complete cds.
GenBank	AY048688	0.0	AY048688.1 Arabidopsis thaliana GARP-like putative transcription factor KANADI1 (KAN1) mRNA, complete cds.
GenBank	BT026436	0.0	BT026436.1 Arabidopsis thaliana At5g16560 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013606692.1	0.0	PREDICTED: transcription repressor KAN1-like
Swissprot	Q93WJ9	1e-135	KAN1_ARATH; Transcription repressor KAN1
TrEMBL	A0A078GU04	0.0	A0A078GU04_BRANA; BnaC09g32160D protein
STRING	Bo9g163080.1	0.0	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM6606	26	45

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G16560.1	1e-123	G2-like family protein

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Huang T,Kerstetter RA,Irish VF APUM23, a PUF family protein, functions in leaf development and organ polarity in Arabidopsis. J. Exp. Bot., 2014. 65(4): p. 1181-91 [PMID:24449383] Mach J Getting in Shape? Leaves work it out with KANADI1. Plant Cell, 2014. 26(1): p. 4 [PMID:24464293] Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Jun SE, et al. Comparative analysis of the conserved functions of Arabidopsis DRL1 and yeast KTI12. Mol. Cells, 2015. 38(3): p. 243-50 [PMID:25518926] Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis. Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71 [PMID:26108442] Xie Y, et al. Meta-Analysis of Arabidopsis KANADI1 Direct Target Genes Identifies a Basic Growth-Promoting Module Acting Upstream of Hormonal Signaling Pathways. Plant Physiol., 2015. 169(2): p. 1240-53 [PMID:26246448] Alvarez JP,Furumizu C,Efroni I,Eshed Y,Bowman JL Active suppression of a leaf meristem orchestrates determinate leaf growth. Elife, 2017. [PMID:27710768] Singh A, et al. Phytohormonal crosstalk modulates the expression of miR166/165s, target Class III HD-ZIPs, and KANADI genes during root growth in Arabidopsis thaliana. Sci Rep, 2017. 7(1): p. 3408 [PMID:28611467] Caggiano MP, et al. Cell type boundaries organize plant development. Elife, 2018. [PMID:28895530] Ó'Maoiléidigh DS,Stewart D,Zheng B,Coupland G,Wellmer F Floral homeotic proteins modulate the genetic program for leaf development to suppress trichome formation in flowers. Development, 2018. [PMID:29361563]