PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00029882001 | ||||||||
Common Name | GSBRNA2T00029882001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 189aa MW: 21168.6 Da PI: 6.7278 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 29.3 | 1.9e-09 | 57 | 102 | 5 | 50 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 + rr NReA r++R++Kka+++ Le++v+ L++ N+ L +l+ GSBRNA2T00029882001 57 SNKRRSCGNREAVRKYREKKKARTAYLEDEVQRLQSMNEFLLRKLQ 102 67899999*******************************9988876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 2.9E-7 | 52 | 120 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 8.5E-12 | 53 | 120 | No hit | No description |
Pfam | PF07716 | 1.4E-15 | 53 | 102 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 9.082 | 55 | 121 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 1.0E-7 | 56 | 103 | No hit | No description |
CDD | cd14686 | 4.25E-10 | 65 | 103 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0042538 | Biological Process | hyperosmotic salinity response | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005737 | Cellular Component | cytoplasm | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 189 aa Download sequence Send to blast |
MDGEEVEAWA RASGGCSHTH SCNPPGPEDA SHSHTCFHTH THLIIPDSQE NGHSDSSNKR 60 RSCGNREAVR KYREKKKART AYLEDEVQRL QSMNEFLLRK LQSQAIVEAE IVRLRTLLVE 120 MQGTMNDELG GFSFQKQCNG SGFVFKEDGC NVATRNMICE VARVECEEGK TLHEPVHSFV 180 PHSPPFSR* |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in young leaves and cauline leaves. {ECO:0000269|PubMed:19248824}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the regulation of salt stress response. Functions as a negative transcriptional regulator of salt stress acclimation response by regulating cation homeostasis (PubMed:18703123, PubMed:19248824). Regulates negatively the expression of genes contributing to ion and osmotic homeostasis during salt stress, such as the Na(+) transporter HKT1, the Na(+)/H(+) antiporter SOS1, the aquaporin PIP2-1 and the glutamine synthetase GLN1-3. In addition, targets genes with functions in plant growth and development, such as argonaute 4 (AGO4) and cyclophilin 19 (CYP19) (PubMed:19248824). {ECO:0000269|PubMed:18703123, ECO:0000269|PubMed:19248824}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00029882001 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt stress (PubMed:18703123, PubMed:19248824). Induced by osmotic stress (PubMed:19248824). {ECO:0000269|PubMed:18703123, ECO:0000269|PubMed:19248824}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK117629 | 1e-159 | AK117629.1 Arabidopsis thaliana At3g51960 mRNA for putative bZip transcription factor Atbzip24, complete cds, clone: RAFL17-28-M01. | |||
GenBank | BT005422 | 1e-159 | BT005422.1 Arabidopsis thaliana clone U50385 putative bZIP family transcription factor (At3g51960) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013631502.1 | 1e-141 | PREDICTED: uncharacterized protein LOC106337035 | ||||
Swissprot | Q8GTS1 | 1e-107 | BZP24_ARATH; Basic leucine zipper 24 | ||||
TrEMBL | A0A078J7J5 | 1e-139 | A0A078J7J5_BRANA; BnaCnng36700D protein | ||||
TrEMBL | A0A3P6C8D1 | 1e-139 | A0A3P6C8D1_BRAOL; Uncharacterized protein | ||||
STRING | Bra033464.1-P | 1e-129 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM15172 | 15 | 18 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G51960.1 | 2e-97 | basic leucine zipper 24 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 106390727 |
Publications ? help Back to Top | |||
---|---|---|---|
|