PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT3G51960.1

Common Name

ATBZIP24, BZIP24, F4F15.70

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

bZIP

Protein Properties

Length: 227aa MW: 26091.3 Da PI: 6.231

Description

basic leucine zipper 24

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT3G51960.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	29.9	1.2e-09	95	142	4	51
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 + + +r+ NReA r++R++Kka+++ Le++v L++ N++ +l++ AT3G51960.1 95 SSNKKRLCGNREAVRKYREKKKARTAYLEDEVMRLQSLNEQFLRKLQS 142 56889***********************************99877764 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.20.5.170	4.8E-10	88	159	No hit	No description
SMART	SM00338	7.1E-7	91	159	IPR004827	Basic-leucine zipper domain
Pfam	PF07716	3.7E-15	92	144	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	8.714	94	160	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	7.5E-7	95	142	No hit	No description
CDD	cd14686	9.97E-9	98	145	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0042538	Biological Process	hyperosmotic salinity response
GO:0005634	Cellular Component	nucleus
GO:0005737	Cellular Component	cytoplasm
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0005515	Molecular Function	protein binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000293	anatomy	guard cell
PO:0006340	anatomy	adult vascular leaf
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009031	anatomy	sepal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0020030	anatomy	cotyledon
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 227 aa Download sequence Send to blast
MFCCCKDCRG NQRVSNFDSL TGVFFGDLEF GPQNQRYIKM NEEEDKDQDR VTRGCSHTHS 60 CNPPGPEDAS HSHTCFHAHT HLIISDQQEN DHSDSSNKKR LCGNREAVRK YREKKKARTA 120 YLEDEVMRLQ SLNEQFLRKL QSQEMVETEL IRLRALLVEM QGKIEVELCS FSFQKQCNGS 180 GFVFKEDGCN LATSNMMCEA ARVECEEGQT LHDPIQSFVP QPPPFSR

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	252083_at	0.0
Expression Atlas	AT3G51960	-
AtGenExpress	AT3G51960	-
ATTED-II	AT3G51960	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in young leaves and cauline leaves. {ECO:0000269\|PubMed:19248824}.

Functional Description ? help Back to Top
Source	Description
TAIR	bZIP transcription factor induced by salt stress and promoted salt tolerance. Localized to the cytoplasm and nucleus under control conditions and targeted preferentially to the nucleus under salt stress
UniProt	Transcription factor involved in the regulation of salt stress response. Functions as a negative transcriptional regulator of salt stress acclimation response by regulating cation homeostasis (PubMed:18703123, PubMed:19248824). Regulates negatively the expression of genes contributing to ion and osmotic homeostasis during salt stress, such as the Na(+) transporter HKT1, the Na(+)/H(+) antiporter SOS1, the aquaporin PIP2-1 and the glutamine synthetase GLN1-3. In addition, targets genes with functions in plant growth and development, such as argonaute 4 (AGO4) and cyclophilin 19 (CYP19) (PubMed:19248824). {ECO:0000269\|PubMed:18703123, ECO:0000269\|PubMed:19248824}.

Function -- GeneRIF ? help Back to Top
Data concluded that basic leucine zipper transcription factor AtbZIP24 (At3g51960) is an important regulator of salt stress response in plants [PMID: 19248824]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT3G51960.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt stress (PubMed:18703123, PubMed:19248824). Induced by osmotic stress (PubMed:19248824). {ECO:0000269\|PubMed:18703123, ECO:0000269\|PubMed:19248824}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT3G51960, AT5G22890
IntAct	Search Q8GTS1

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT3G51960

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK117629	0.0	AK117629.1 Arabidopsis thaliana At3g51960 mRNA for putative bZip transcription factor Atbzip24, complete cds, clone: RAFL17-28-M01.
GenBank	BT005422	0.0	BT005422.1 Arabidopsis thaliana clone U50385 putative bZIP family transcription factor (At3g51960) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_850680.1	1e-170	basic leucine zipper 24
Swissprot	Q8GTS1	1e-171	BZP24_ARATH; Basic leucine zipper 24
TrEMBL	A0A384KLK2	1e-167	A0A384KLK2_ARATH; BZIP24
TrEMBL	F4J5N9	1e-167	F4J5N9_ARATH; Basic leucine zipper 24
STRING	AT3G51960.2	1e-168	(Arabidopsis thaliana)

Link Out ? help Back to Top
Phytozome	AT3G51960.1
Entrez Gene	824359
iHOP	AT3G51960
wikigenes	AT3G51960

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Jakoby M, et al. bZIP transcription factors in Arabidopsis. Trends Plant Sci., 2002. 7(3): p. 106-11 [PMID:11906833] Seki M, et al. Functional annotation of a full-length Arabidopsis cDNA collection. Science, 2002. 296(5565): p. 141-5 [PMID:11910074] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Satoh R,Fujita Y,Nakashima K,Shinozaki K,Yamaguchi-Shinozaki K A novel subgroup of bZIP proteins functions as transcriptional activators in hypoosmolarity-responsive expression of the ProDH gene in Arabidopsis. Plant Cell Physiol., 2004. 45(3): p. 309-17 [PMID:15047879] Deppmann CD, et al. Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs. Nucleic Acids Res., 2004. 32(11): p. 3435-45 [PMID:15226410] Deppmann CD,Alvania RS,Taparowsky EJ Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks. Mol. Biol. Evol., 2006. 23(8): p. 1480-92 [PMID:16731568] Cheng C, et al. An early response regulatory cluster induced by low temperature and hydrogen peroxide in seedlings of chilling-tolerant japonica rice. BMC Genomics, 2007. 8: p. 175 [PMID:17577400] Popova OV,Yang O,Dietz KJ,Golldack D Differential transcript regulation in Arabidopsis thaliana and the halotolerant Lobularia maritima indicates genes with potential function in plant salt adaptation. Gene, 2008. 423(2): p. 142-8 [PMID:18703123] Yang O, et al. The Arabidopsis basic leucine zipper transcription factor AtbZIP24 regulates complex transcriptional networks involved in abiotic stress resistance. Gene, 2009. 436(1-2): p. 45-55 [PMID:19248824] Hanada K, et al. Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana. Mol. Biol. Evol., 2011. 28(1): p. 377-82 [PMID:20736450] Arabidopsis Interactome Mapping Consortium Evidence for network evolution in an Arabidopsis interactome map. Science, 2011. 333(6042): p. 601-7 [PMID:21798944]