PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00024989001 | ||||||||
Common Name | GSBRNA2T00066516001, LOC106443352 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 75aa MW: 9021.21 Da PI: 9.6056 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 26 | 2.2e-08 | 2 | 40 | 5 | 45 |
-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 T++E++l+ + ++ G + W++Ia +++ gR ++++ +w GSBRNA2T00024989001 2 TEQEEDLICRMYRLVGDR-WDLIAGRVP-GRQPEEIERYWI 40 9***************99.*********.***********5 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
CDD | cd00167 | 1.12E-5 | 1 | 39 | No hit | No description |
PROSITE profile | PS51294 | 10.615 | 1 | 47 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.8E-10 | 2 | 40 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.1E-7 | 2 | 40 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.01E-7 | 2 | 40 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 75 aa Download sequence Send to blast |
MTEQEEDLIC RMYRLVGDRW DLIAGRVPGR QPEEIERYWI MRNSDGFAEK RRQLHHSSHK 60 NTKPYRPRFS VYPS* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Bna.13314 | 2e-85 | seed |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Ubiquitous in young leaves. Later, restricted to the leaf base in the trichome initiation zone. In mature leaves, confined to trichome cells. {ECO:0000269|PubMed:12356720}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, leaves, siliques and inflorescences. {ECO:0000269|PubMed:12356720}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00024989001 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC232446 | 1e-85 | AC232446.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB006G23, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013626756.1 | 2e-50 | PREDICTED: transcription factor TRY | ||||
Refseq | XP_013740369.1 | 2e-50 | transcription factor TRY | ||||
Swissprot | Q8GV05 | 1e-45 | TRY_ARATH; Transcription factor TRY | ||||
TrEMBL | A0A078HPL2 | 5e-49 | A0A078HPL2_BRANA; BnaC03g15160D protein | ||||
TrEMBL | A0A0D3B3Q8 | 5e-49 | A0A0D3B3Q8_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6AKP8 | 5e-49 | A0A3P6AKP8_BRAOL; Uncharacterized protein | ||||
STRING | Bo3g022870.1 | 8e-50 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM323 | 28 | 194 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G53200.1 | 6e-48 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 106443352 |