PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00022517001

Common Name

GSBRNA2T00022517001

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

bZIP

Protein Properties

Length: 255aa MW: 27956.4 Da PI: 6.8763

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00022517001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	34.2	5.6e-11	191	238	5	52
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 kr++r NR +A rs +RK +++ eLe+kv++L++e ++L ++ +l GSBRNA2T00022517001 191 KRAKRILANRQSAARSKERKIKYTGELERKVQTLQNEATTLSAQVTML 238 9****************************************9988776 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	3.0E-8	187	249	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	9.933	189	239	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	1.7E-11	191	239	No hit	No description
Pfam	PF00170	1.6E-9	191	236	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	2.38E-11	191	244	No hit	No description
CDD	cd14703	2.63E-23	192	239	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 255 aa Download sequence Send to blast
MEPSSLRANQ SSILSEIERM PEAPRQRISH HRRARSDTFF SGESIDDLLL FDPSDVDFSS 60 LDFLNAPTPQ TQPQPQPSPM SVDSPPEETS SNGAPPIPLP PGRHVRSFSV DSESNFFDDL 120 AATEDTQFAR PTSSGGRKGH HHRSNSMDGA TSSGSFNMDS ILAAVNCKDG AKKNMGMASD 180 RLAELALLDP KRAKRILANR QSAARSKERK IKYTGELERK VQTLQNEATT LSAQVTMLQV 240 ITLFLFIHCL CLCI*

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Bna.5132	0.0	seed

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Mostly expressed in dividing cells, present in leaves, roots and seedlings. {ECO:0000269\|PubMed:15108305, ECO:0000269\|PubMed:15824315}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds specifically to the VIP1 response elements (VREs) DNA sequence 5'-ACNGCT-3' found in some stress genes (e.g. TRX8 and MYB44), when phosphorylated/activated by MPK3. Required for Agrobacterium VirE2 nuclear import and tumorigenicity. Promotes transient expression of T-DNA in early stages by interacting with VirE2 in complex with the T-DNA and facilitating its translocation to the nucleus, and mediates stable genetic transformation by Agrobacterium by binding H2A histone. Prevents cell differentiation and shoot formation. Limits sulfate utilization efficiency (SUE) and sulfate uptake, especially in low-sulfur conditions. {ECO:0000269\|PubMed:11432846, ECO:0000269\|PubMed:12124400, ECO:0000269\|PubMed:15108305, ECO:0000269\|PubMed:15824315, ECO:0000269\|PubMed:17947581, ECO:0000269\|PubMed:19820165, ECO:0000269\|PubMed:20547563}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00022517001

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Transcriptionally activated during the acquisition of pluripotentiality (in protoplasts) by pericentromeric chromatin decondensation and DNA demethylation. Targeted to degradation by the proteasome by VBF and Agrobacterium virF in SCF(VBF) and SCF(virF) E3 ubiquitin ligase complexes after mediating T-DNA translocation to the nucleus. {ECO:0000269\|PubMed:15108305}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KR537434	0.0	KR537434.1 Brassica napus cultivar SLM046 VirE2-interacting protein 1 (VIP1) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009145063.1	1e-174	PREDICTED: transcription factor VIP1-like
Swissprot	Q9MA75	1e-109	VIP1_ARATH; Transcription factor VIP1
TrEMBL	A0A078JZY9	0.0	A0A078JZY9_BRANA; BnaAnng39310D protein
STRING	Bra032191.1-P	1e-173	(Brassica rapa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM7993	26	39

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G43700.1	1e-110	VIRE2-interacting protein 1

Publications ? help Back to Top
Wang Y, et al. The putative Agrobacterium transcriptional activator-like virulence protein VirD5 may target T-complex to prevent the degradation of coat proteins in the plant cell nucleus. New Phytol., 2014. 203(4): p. 1266-81 [PMID:24865527] Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Xu DB, et al. A G-protein β subunit, AGB1, negatively regulates the ABA response and drought tolerance by down-regulating AtMPK6-related pathway in Arabidopsis. PLoS ONE, 2015. 10(1): p. e0116385 [PMID:25635681] Chen J, et al. ZmbZIP91 regulates expression of starch synthesis-related genes by binding to ACTCAT elements in their promoters. J. Exp. Bot., 2016. 67(5): p. 1327-38 [PMID:26689855] Tsugama D,Liu S,Takano T VIP1 is very important/interesting protein 1 regulating touch responses of Arabidopsis. Plant Signal Behav, 2016. 11(6): p. e1187358 [PMID:27171129] Tsugama D,Liu S,Takano T The bZIP Protein VIP1 Is Involved in Touch Responses in Arabidopsis Roots. Plant Physiol., 2016. 171(2): p. 1355-65 [PMID:27208231] Takeo K,Ito T Subcellular localization of VIP1 is regulated by phosphorylation and 14-3-3 proteins. FEBS Lett., 2017. 591(13): p. 1972-1981 [PMID:28542772] Wang L,Lacroix B,Guo J,Citovsky V The Agrobacterium VirE2 effector interacts with multiple members of the Arabidopsis VIP1 protein family. Mol. Plant Pathol., 2018. 19(5): p. 1172-1183 [PMID:28802023]