PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00017484001 | ||||||||
Common Name | GSBRNA2T00017484001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 210aa MW: 24240.3 Da PI: 6.5128 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 46.9 | 6.5e-15 | 16 | 63 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg W+ +Ed++l+ ++++G ++W++ ++ g+ R++k+c++rw +yl GSBRNA2T00017484001 16 RGQWSYDEDLKLISFINKYGHENWRSLPEQAGLLRCGKSCRLRWINYL 63 89******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 40.2 | 7.9e-13 | 69 | 108 | 1 | 42 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcks 42 rg+++ +E+e ++++++ G++ W++Ia++++ gRt++++k+ GSBRNA2T00017484001 69 RGNFSVDEEETIIKLHQSIGSK-WSKIASKLP-GRTDNEIKN 108 89********************.*********.*******97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 6.9E-23 | 7 | 66 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 19.178 | 11 | 67 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.87E-27 | 14 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.6E-10 | 15 | 65 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.8E-14 | 16 | 63 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.57E-8 | 19 | 63 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 3.4E-20 | 67 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 7.7E-8 | 68 | 116 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 11.973 | 68 | 118 | IPR017930 | Myb domain |
Pfam | PF00249 | 1.7E-11 | 69 | 108 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.47E-6 | 71 | 108 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 210 aa Download sequence Send to blast |
MGKGRAPCCD KTKVKRGQWS YDEDLKLISF INKYGHENWR SLPEQAGLLR CGKSCRLRWI 60 NYLRPDVKRG NFSVDEEETI IKLHQSIGSK WSKIASKLPG RTDNEIKNVT LQEVDKPELL 120 EIPFGVDPEI WSFINGLDSF QQPENSLAPW AHQDSQEDEV EKWFKHLETE LGLEENDSQQ 180 QQSIVMLTKN HRHHHLGELR ALDTPLTKP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-20 | 16 | 108 | 7 | 98 | B-MYB |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Bna.21428 | 1e-63 | stem |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: In nonelongating internodes, highly expressed in interfascicular fibers and xylem cells but not in parenchymatous pith cells. In elongating internodes, predominantly expressed in protoxylem vessels. {ECO:0000269|PubMed:19122102}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in leaves (PubMed:9839469). Specifically expressed in fibers and vessels undergoing secondary wall thickening, especially in inflorescence stems (PubMed:19122102). {ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:9839469}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that binds DNA to the AC cis-elements 5'-ACCTACC-3', 5'-ACCAACC-3' and 5'-ACCTAAC-3' of promoters and specifically activates lignin biosynthetic genes during secondary wall formation mediated by SND1. {ECO:0000269|PubMed:19122102}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00017484001 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly induced by light (PubMed:9839469). Regulated by the SND1 close homologs NST1, NST2, VND6, and VND7 and their downstream targets MYB46 and MYB83 (PubMed:19122102, PubMed:22197883). {ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:22197883, ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB493459 | 1e-118 | AB493459.1 Arabidopsis thaliana At1g16490 mRNA for hypothetical protein, partial cds, clone: RAAt1g16490. | |||
GenBank | AY085461 | 1e-118 | AY085461.1 Arabidopsis thaliana clone 152630 mRNA, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018515313.1 | 1e-74 | PREDICTED: myb-related protein Myb4-like | ||||
Refseq | XP_022543897.1 | 1e-74 | transcription factor MYB58-like | ||||
Swissprot | Q9SA47 | 6e-69 | MYB58_ARATH; Transcription factor MYB58 | ||||
TrEMBL | A0A078IZB5 | 1e-153 | A0A078IZB5_BRANA; BnaCnng29520D protein | ||||
STRING | Bra026048.1-P | 5e-74 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G16490.1 | 2e-71 | myb domain protein 58 |
Publications ? help Back to Top | |||
---|---|---|---|
|