PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00017372001 | ||||||||
Common Name | GSBRNA2T00017372001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 222aa MW: 25158.7 Da PI: 9.0929 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 93.9 | 7.2e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRrng+lKKA+ELSvLCdaeva+iifs+t klye+ss GSBRNA2T00017372001 9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPTSKLYEFSS 59 79***********************************************96 PP | |||||||
2 | K-box | 76.7 | 6.3e-26 | 81 | 170 | 9 | 98 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 + +a++++ + e L k+ie+L+ ++R++lGe+++ +s++eL+qLe+qLe++l++iR+kK++ll+e+i++l++ e++l +enk+L++kl GSBRNA2T00017372001 81 KRDADSQQARGETYGLTKKIEQLEITKRKMLGEGIDVCSIEELHQLENQLERGLTRIRAKKYQLLREEIDKLKEEERNLIKENKELNEKL 170 567888999999***************************************************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 31.553 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.4E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 4.24E-41 | 3 | 70 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.6E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.44E-32 | 3 | 73 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.5E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.6E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.6E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 6.3E-25 | 84 | 170 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.5 | 86 | 176 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 222 aa Download sequence Send to blast |
MVRGKTEMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALIIFSP TSKLYEFSSS 60 SISKTIERYQ RRVTEIGINH KRDADSQQAR GETYGLTKKI EQLEITKRKM LGEGIDVCSI 120 EELHQLENQL ERGLTRIRAK KYQLLREEID KLKEEERNLI KENKELNEKL SGMGAIVVAS 180 SSSTLTSSEV NTDGNDSMEV ETGLFIGPPE PRQSKKIYPQ C* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 2e-19 | 1 | 69 | 1 | 69 | MEF2C |
5f28_B | 2e-19 | 1 | 69 | 1 | 69 | MEF2C |
5f28_C | 2e-19 | 1 | 69 | 1 | 69 | MEF2C |
5f28_D | 2e-19 | 1 | 69 | 1 | 69 | MEF2C |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Mostly expressed in the outer layers of the root meristem (lateral root cap and epidermis) and in the central cylinder cells of mature roots. Also present in rosette leaves and seedlings and, to a lesser extent, in cauline leaves and flowers. Enriched in apices including the shoot apical meristem and developing leaf primordia. {ECO:0000269|PubMed:11115127, ECO:0000269|PubMed:12837945, ECO:0000269|PubMed:12949148, ECO:0000269|PubMed:16778081}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that promotes flowering, especially in response to vernalization by short periods of cold, in an FLC-inpedendent manner. {ECO:0000269|PubMed:16778081}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00017372001 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Maintained at very low levels by the polycomb-group (PcG) proteins MSI1, CLF, and EMF2 via histone methylation (H3K27me3). Derepressed upon cold treatment (vernalization). {ECO:0000269|PubMed:16778081}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009108594.1 | 1e-159 | PREDICTED: agamous-like MADS-box protein AGL19 | ||||
Refseq | XP_009108595.1 | 1e-159 | PREDICTED: agamous-like MADS-box protein AGL19 | ||||
Refseq | XP_013663878.1 | 1e-159 | agamous-like MADS-box protein AGL19 | ||||
Refseq | XP_013663879.1 | 1e-159 | agamous-like MADS-box protein AGL19 | ||||
Swissprot | O82743 | 1e-121 | AGL19_ARATH; Agamous-like MADS-box protein AGL19 | ||||
TrEMBL | A0A078IZ81 | 1e-159 | A0A078IZ81_BRANA; BnaCnng29230D protein | ||||
STRING | Bo3g165710.1 | 1e-158 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM78 | 28 | 413 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G22950.1 | 1e-123 | AGAMOUS-like 19 |
Publications ? help Back to Top | |||
---|---|---|---|
|