PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00009408001 | ||||||||
Common Name | GSBRNA2T00009407001, GSBRNA2T00009408001, LOC106418227, LOC106430551 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 108aa MW: 13054.6 Da PI: 10.1453 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 27.9 | 5.5e-09 | 33 | 72 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 +T++E++l+ + +++ G + W++Ia +++ gR ++++ +w GSBRNA2T00009408001 33 MTEQEEDLIFRMHRLVGDR-WDLIAGRVP-GRQPEEIERYWI 72 7****************99.*********.***********5 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 1.3E-6 | 29 | 77 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.32E-6 | 32 | 71 | No hit | No description |
Pfam | PF00249 | 2.4E-8 | 33 | 72 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS50090 | 6.284 | 34 | 71 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 9.5E-11 | 34 | 72 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.17E-7 | 34 | 72 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010091 | Biological Process | trichome branching | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 108 aa Download sequence Send to blast |
MDNTDRRRRR KQHKATLHDS EEVSSIEWEF INMTEQEEDL IFRMHRLVGD RWDLIAGRVP 60 GRQPEEIERY WIMRNSDGFA EKRRQLHHSS SHKSTKPHRP RFSIYPS* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Bna.13314 | 1e-179 | seed |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Ubiquitous in young leaves. Later, restricted to the leaf base in the trichome initiation zone. In mature leaves, confined to trichome cells. {ECO:0000269|PubMed:12356720}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, leaves, siliques and inflorescences. {ECO:0000269|PubMed:12356720}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00009408001 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF188211 | 1e-172 | KF188211.1 Brassica villosa BVTRY-1 (BVTRY-1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013714345.1 | 2e-74 | transcription factor TRY | ||||
Refseq | XP_013726794.1 | 2e-74 | transcription factor TRY | ||||
Refseq | XP_022565509.1 | 2e-74 | transcription factor TRY | ||||
Swissprot | Q8GV05 | 3e-68 | TRY_ARATH; Transcription factor TRY | ||||
TrEMBL | A0A078G3V4 | 5e-73 | A0A078G3V4_BRANA; BnaC09g29430D protein | ||||
STRING | fgenesh1_pg.C_scaffold_8001350 | 2e-67 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM323 | 28 | 194 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G53200.1 | 3e-61 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 106418227 | 106430551 |