PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Bradi3g32090.1.p | ||||||||
Common Name | BRADI_3g32090, LOC100823796 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 228aa MW: 25690.5 Da PI: 9.7545 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 94.3 | 5.7e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++ rqvtfskRrng+lKKA+ELSvLCdaeva+++fs++g+lye++s Bradi3g32090.1.p 9 KRIENTTSRQVTFSKRRNGLLKKAFELSVLCDAEVALVVFSPRGRLYEFAS 59 79***********************************************86 PP | |||||||
2 | K-box | 60.2 | 8.6e-21 | 78 | 172 | 5 | 99 |
K-box 5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 +k++++++ ++ + + L k++e L+ ++R++lGe+L++++ +eL+ Le ++eksl iR+kK++ll +qi +l++ke +l ++n++Lr+k Bradi3g32090.1.p 78 VNKKTAQQDIQQIRADTVGLAKKLEALEDSKRKILGENLGECTTQELHILEAKIEKSLHIIRAKKSQLLERQIAKLKEKETMLLKDNEELREK 170 445588999999999****************************************************************************99 PP K-box 98 le 99 + Bradi3g32090.1.p 171 QQ 172 75 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 4.2E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.707 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.45E-39 | 3 | 76 | No hit | No description |
PRINTS | PR00404 | 5.8E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.31E-31 | 3 | 84 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 5.9E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.8E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.8E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 2.1E-21 | 83 | 170 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 12.517 | 87 | 177 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000060 | Biological Process | protein import into nucleus, translocation | ||||
GO:0009409 | Biological Process | response to cold | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0009911 | Biological Process | positive regulation of flower development | ||||
GO:0010077 | Biological Process | maintenance of inflorescence meristem identity | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005737 | Cellular Component | cytoplasm | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008134 | Molecular Function | transcription factor binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 228 aa Download sequence Send to blast |
MVRGKTELKR IENTTSRQVT FSKRRNGLLK KAFELSVLCD AEVALVVFSP RGRLYEFASS 60 ASLQKTIDRY KAYTKDNVNK KTAQQDIQQI RADTVGLAKK LEALEDSKRK ILGENLGECT 120 TQELHILEAK IEKSLHIIRA KKSQLLERQI AKLKEKETML LKDNEELREK QQHLAALMVV 180 PSLNHVALSP LQPEPEPEPS SDAIDTVETE LYIGLPGRER SSNRQSG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3mu6_A | 1e-17 | 3 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3mu6_B | 1e-17 | 3 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3mu6_C | 1e-17 | 3 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3mu6_D | 1e-17 | 3 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00076 | ChIP-chip | Transfer from AT2G45660 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Bradi3g32090.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF469320 | 0.0 | KF469320.1 Brachypodium distachyon MADS-box transcription factor 25 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001288329.1 | 1e-165 | MADS-box transcription factor 56-like | ||||
Refseq | XP_010233635.1 | 1e-165 | MADS-box transcription factor 56-like isoform X1 | ||||
Swissprot | A2Z9Q7 | 1e-107 | MAD56_ORYSI; MADS-box transcription factor 56 | ||||
TrEMBL | I1I5Q0 | 1e-164 | I1I5Q0_BRADI; MADS-box transcription factor 25 | ||||
STRING | BRADI3G32090.1 | 1e-164 | (Brachypodium distachyon) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1413 | 33 | 79 | Representative plant | OGRP16 | 17 | 761 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45660.1 | 4e-68 | AGAMOUS-like 20 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Bradi3g32090.1.p |
Entrez Gene | 100823796 |
Publications ? help Back to Top | |||
---|---|---|---|
|