PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Bradi2g60030.3.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 181aa MW: 18783 Da PI: 8.5104 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 129 | 1.7e-40 | 45 | 133 | 7 | 95 |
NF-YB 7 flPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 +lPianv+rimk +lP +ak+sk ake +qec++ef++fvt+eas++c+re+rkt+ngdd+++a+ +lG+++y++++ yl+++re+e+ Bradi2g60030.3.p 45 LLPIANVGRIMKGALPPEAKVSKRAKEAIQECATEFVAFVTGEASQRCRRERRKTVNGDDVCHAMRSLGLDHYAAAMGRYLQRHREAEE 133 79************************************************************************************985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.2E-38 | 45 | 140 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 3.87E-30 | 45 | 137 | IPR009072 | Histone-fold |
Pfam | PF00808 | 6.2E-22 | 46 | 109 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.3E-11 | 73 | 91 | No hit | No description |
PRINTS | PR00615 | 1.3E-11 | 92 | 110 | No hit | No description |
PRINTS | PR00615 | 1.3E-11 | 111 | 129 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 181 aa Download sequence Send to blast |
MSDTFNLSGF TLPGPTPRIS HASTSAVGAG AGPGEEEEHQ GGGGLLPIAN VGRIMKGALP 60 PEAKVSKRAK EAIQECATEF VAFVTGEASQ RCRRERRKTV NGDDVCHAMR SLGLDHYAAA 120 MGRYLQRHRE AEELAAEING RSVGGGGVPD FGGQIDVRAQ LSVSGSRAGA GGSEKRLGRN 180 * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 4e-35 | 46 | 130 | 8 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 4e-35 | 46 | 130 | 8 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Bradi2g60030.3.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024315117.1 | 1e-128 | nuclear transcription factor Y subunit B-4-like | ||||
Swissprot | O04027 | 2e-41 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
TrEMBL | I1HUZ2 | 1e-126 | I1HUZ2_BRADI; Uncharacterized protein | ||||
STRING | BRADI2G60030.1 | 1e-127 | (Brachypodium distachyon) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2917 | 38 | 87 | Representative plant | OGRP168 | 17 | 170 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09030.1 | 1e-41 | nuclear factor Y, subunit B4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Bradi2g60030.3.p |
Publications ? help Back to Top | |||
---|---|---|---|
|