PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Bradi2g12590.1.p | ||||||||
Common Name | BRADI_2g12590, LOC100827983 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 132aa MW: 14295.1 Da PI: 9.0256 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 57.8 | 1.5e-18 | 21 | 54 | 1 | 34 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 C+ C+tt+Tp+WR gp g ++LCnaCG++yrkk+ Bradi2g12590.1.p 21 CVECRTTTTPMWRGGPTGRRSLCNACGIRYRKKK 54 ********************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50114 | 12.861 | 15 | 51 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 6.1E-16 | 15 | 65 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 1.28E-13 | 18 | 58 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 1.9E-16 | 19 | 56 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 4.88E-13 | 20 | 56 | No hit | No description |
Pfam | PF00320 | 2.1E-16 | 21 | 55 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 21 | 46 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0045944 | Biological Process | positive regulation of transcription from RNA polymerase II promoter | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005667 | Cellular Component | transcription factor complex | ||||
GO:0000977 | Molecular Function | RNA polymerase II regulatory region sequence-specific DNA binding | ||||
GO:0001085 | Molecular Function | RNA polymerase II transcription factor binding | ||||
GO:0001228 | Molecular Function | transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding | ||||
GO:0003682 | Molecular Function | chromatin binding | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 132 aa Download sequence Send to blast |
MGSSDRKVDG IGVVEEGRRS CVECRTTTTP MWRGGPTGRR SLCNACGIRY RKKKRQDLSL 60 DQKEPPPRQQ QHNGEEAITA EVKDSTSNSN SSSGSSNLQV VQERKLLMGV EEAALLLMTL 120 SSPPPSTLLH G* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Bradi2g12590.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FP096799 | 1e-58 | FP096799.1 Phyllostachys edulis cDNA clone: bphylf042b12, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003567660.1 | 3e-92 | GATA transcription factor 23 | ||||
TrEMBL | I1HF65 | 8e-91 | I1HF65_BRADI; Uncharacterized protein | ||||
STRING | BRADI2G12590.1 | 1e-91 | (Brachypodium distachyon) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6721 | 28 | 54 | Representative plant | OGRP68 | 17 | 287 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26930.1 | 1e-17 | GATA transcription factor 23 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Bradi2g12590.1.p |
Entrez Gene | 100827983 |