PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g12590.1.p
Common NameBRADI_2g12590, LOC100827983
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GATA
Protein Properties Length: 132aa    MW: 14295.1 Da    PI: 9.0256
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g12590.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.81.5e-182154134
              GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
                      C+ C+tt+Tp+WR gp g ++LCnaCG++yrkk+
  Bradi2g12590.1.p 21 CVECRTTTTPMWRGGPTGRRSLCNACGIRYRKKK 54
                      ********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.8611551IPR000679Zinc finger, GATA-type
SMARTSM004016.1E-161565IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.28E-131858No hitNo description
Gene3DG3DSA:3.30.50.101.9E-161956IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.88E-132056No hitNo description
PfamPF003202.1E-162155IPR000679Zinc finger, GATA-type
PROSITE patternPS0034402146IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MGSSDRKVDG IGVVEEGRRS CVECRTTTTP MWRGGPTGRR SLCNACGIRY RKKKRQDLSL  60
DQKEPPPRQQ QHNGEEAITA EVKDSTSNSN SSSGSSNLQV VQERKLLMGV EEAALLLMTL  120
SSPPPSTLLH G*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g12590.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0967991e-58FP096799.1 Phyllostachys edulis cDNA clone: bphylf042b12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003567660.13e-92GATA transcription factor 23
TrEMBLI1HF658e-91I1HF65_BRADI; Uncharacterized protein
STRINGBRADI2G12590.11e-91(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67212854
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26930.11e-17GATA transcription factor 23