PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm_27.model.AmTr_v1.0_scaffold00059.116 | ||||||||
Common Name | AMTR_s00059p00136790 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
|
||||||||
Family | BES1 | ||||||||
Protein Properties | Length: 144aa MW: 15723.9 Da PI: 9.5109 | ||||||||
Description | BES1 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF822 | 161.7 | 4.6e-50 | 16 | 88 | 2 | 74 |
DUF822 2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkg 72 +gr ptwkErEnnkrRERrRRaiaakiyaGLRa Gnyklpk++DnneVlkALcreAGw+ve+DGttyrk evm_27.model.AmTr_v1.0_scaffold00059.116 16 VGGRLPTWKERENNKRRERRRRAIAAKIYAGLRASGNYKLPKHCDNNEVLKALCREAGWTVEEDGTTYRKL 86 689******************************************************************86 PP DUF822 73 sk 74 + evm_27.model.AmTr_v1.0_scaffold00059.116 87 NS 88 55 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05687 | 3.2E-46 | 17 | 87 | IPR008540 | BES1/BZR1 plant transcription factor, N-terminal |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0016021 | Cellular Component | integral component of membrane |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 144 aa Download sequence Send to blast |
MTSGGGGGGG GGGGGVGGRL PTWKERENNK RRERRRRAIA AKIYAGLRAS GNYKLPKHCD 60 NNEVLKALCR EAGWTVEEDG TTYRKLNSNF YPLCFWSGSG VSAEAIESQL VLTVLLFYFD 120 LASGFIPSSV IFELTVIFFF FFH* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5zd4_A | 1e-23 | 19 | 85 | 372 | 438 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_B | 1e-23 | 19 | 85 | 372 | 438 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_C | 1e-23 | 19 | 85 | 372 | 438 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_D | 1e-23 | 19 | 85 | 372 | 438 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | May function in brassinosteroid signaling. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006856105.2 | 8e-56 | BES1/BZR1 homolog protein 1 | ||||
Swissprot | Q6EUF1 | 8e-28 | BZR4_ORYSJ; Protein BZR1 homolog 4 | ||||
TrEMBL | U5CW90 | 1e-100 | U5CW90_AMBTC; Uncharacterized protein | ||||
STRING | ERN17571 | 1e-100 | (Amborella trichopoda) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP1595 | 15 | 42 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G36780.1 | 8e-24 | BES1/BZR1 homolog 2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm_27.model.AmTr_v1.0_scaffold00059.116 |
Publications ? help Back to Top | |||
---|---|---|---|
|