PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm_27.model.AmTr_v1.0_scaffold00022.163 | ||||||||
Common Name | AMTR_s00022p00160350 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 175aa MW: 19659.4 Da PI: 7.5435 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 179 | 1.3e-55 | 15 | 143 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkya 69 lppGfrFhPtdeel+++yL+ kv + + ++ i+evd++++ePw+Lp+ +k +ekewyfFs rd+ky+ evm_27.model.AmTr_v1.0_scaffold00022.163 15 LPPGFRFHPTDEELIMFYLATKVFNPSGSTPVSIAEVDLNRCEPWELPEIAKMGEKEWYFFSLRDRKYP 83 79**********************999777556***************8888899************** PP NAM 70 tgkrknratksgyWkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128 tg+r+nrat++gyWkatgkd+e++s+ +g lvg+kktLvfy+grapkg+kt+Wvmheyrl evm_27.model.AmTr_v1.0_scaffold00022.163 84 TGHRTNRATDAGYWKATGKDREIHSAtNGVLVGMKKTLVFYRGRAPKGQKTNWVMHEYRL 143 ************************9978889***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 7.06E-61 | 10 | 153 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 56.524 | 15 | 158 | IPR003441 | NAC domain |
Pfam | PF02365 | 9.3E-29 | 16 | 143 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010014 | Biological Process | meristem initiation | ||||
GO:0010199 | Biological Process | organ boundary specification between lateral organs and the meristem | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 175 aa Download sequence Send to blast |
MEGVCLCEET NEQGLPPGFR FHPTDEELIM FYLATKVFNP SGSTPVSIAE VDLNRCEPWE 60 LPEIAKMGEK EWYFFSLRDR KYPTGHRTNR ATDAGYWKAT GKDREIHSAT NGVLVGMKKT 120 LVFYRGRAPK GQKTNWVMHE YRLQGDFSYH LACKLDASTV GVAAASPVGH GWIL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 4e-50 | 3 | 156 | 8 | 158 | NAC domain-containing protein 19 |
3swm_B | 4e-50 | 3 | 156 | 8 | 158 | NAC domain-containing protein 19 |
3swm_C | 4e-50 | 3 | 156 | 8 | 158 | NAC domain-containing protein 19 |
3swm_D | 4e-50 | 3 | 156 | 8 | 158 | NAC domain-containing protein 19 |
3swp_A | 4e-50 | 3 | 156 | 8 | 158 | NAC domain-containing protein 19 |
3swp_B | 4e-50 | 3 | 156 | 8 | 158 | NAC domain-containing protein 19 |
3swp_C | 4e-50 | 3 | 156 | 8 | 158 | NAC domain-containing protein 19 |
3swp_D | 4e-50 | 3 | 156 | 8 | 158 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for axillary meristem initiation and separation of the meristem from the main stem. May act as an inhibitor of cell division. {ECO:0000269|PubMed:12837947, ECO:0000269|PubMed:17122068}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00241 | DAP | Transfer from AT1G76420 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. {ECO:0000269|PubMed:16854978}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FR668079 | 0.0 | FR668079.1 Amborella trichopoda mRNA for CUC3 protein. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001292757.1 | 1e-114 | uncharacterized protein LOC18439762 | ||||
Swissprot | Q9S851 | 2e-77 | NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3 | ||||
TrEMBL | W1PUQ6 | 1e-129 | W1PUQ6_AMBTC; Uncharacterized protein | ||||
STRING | ERN11564 | 1e-130 | (Amborella trichopoda) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP17 | 15 | 800 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G76420.1 | 9e-80 | NAC family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm_27.model.AmTr_v1.0_scaffold00022.163 |