PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT1G76420.1

Common Name

ANAC031, CUC3, F14G6.2, F15M4.8, NAC031, NAC368

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

NAC

Protein Properties

Length: 334aa MW: 38017.6 Da PI: 6.4644

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G76420.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	172.5	1.3e-53	22	150	1	129
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 lppGfrFhPtdeel+++yL+ k+ + l+ +i+evd++++ePw+Lp+++k +e+ewyf+s rd+ky+tg r+nrat++gyWkatgkdkev+s +g AT1G76420.1 22 LPPGFRFHPTDEELITFYLASKIFHGGLSG-IHISEVDLNRCEPWELPEMAKMGEREWYFYSLRDRKYPTGLRTNRATTAGYWKATGKDKEVFSGgGG 118 79***********************999.78***********9889999***********************************9788 PP NAM 98 elvglkktLvfykgrapkgektdWvmheyrle 129 +lvg+kktLvfykgrap+g kt+Wvmheyrle AT1G76420.1 119 QLVGMKKTLVFYKGRAPRGLKTKWVMHEYRLE 150 89**************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.15E-63	17	171	IPR003441	NAC domain
PROSITE profile	PS51005	59.639	22	171	IPR003441	NAC domain
Pfam	PF02365	1.0E-26	23	149	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0010014	Biological Process	meristem initiation
GO:0010199	Biological Process	organ boundary specification between lateral organs and the meristem
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000037	anatomy	shoot apex
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009052	anatomy	flower pedicel
PO:0020100	anatomy	hypocotyl
PO:0025022	anatomy	collective leaf structure
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 334 aa Download sequence Send to blast
MMLAVEDVLS ELAGEERNER GLPPGFRFHP TDEELITFYL ASKIFHGGLS GIHISEVDLN 60 RCEPWELPEM AKMGEREWYF YSLRDRKYPT GLRTNRATTA GYWKATGKDK EVFSGGGGQL 120 VGMKKTLVFY KGRAPRGLKT KWVMHEYRLE NDHSHRHTCK EEWVICRVFN KTGDRKNVGL 180 IHNQISYLHN HSLSTTHHHH HEALPLLIEP SNKTLTNFPS LLYDDPHQNY NNNNFLHGSS 240 GHNIDELKAL INPVVSQLNG IIFPSGNNNN DEDDFDFNLG VKTEQSSNGN EIDVRDYLEN 300 PLFQEASYGL LGFSSSPGPL HMLLDSPCPL GFQL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3swm_A	2e-50	22	171	20	168	NAC domain-containing protein 19
3swm_B	2e-50	22	171	20	168	NAC domain-containing protein 19
3swm_C	2e-50	22	171	20	168	NAC domain-containing protein 19
3swm_D	2e-50	22	171	20	168	NAC domain-containing protein 19
3swp_A	2e-50	22	171	20	168	NAC domain-containing protein 19
3swp_B	2e-50	22	171	20	168	NAC domain-containing protein 19
3swp_C	2e-50	22	171	20	168	NAC domain-containing protein 19
3swp_D	2e-50	22	171	20	168	NAC domain-containing protein 19
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	145337629	0.0
Genevisible	259972_at	0.0
Expression Atlas	AT1G76420	-
AtGenExpress	AT1G76420	-
ATTED-II	AT1G76420	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: First expressed at the globular stage, mostly in the apical part of the embryo. During the triangular stage, confined to the boundary of emerging cotyledons. Later restricted to the center of the apical part of the embryo and to seedling apex, at the boundaries of the cotyledon margins and the boundaries between the SAM and the cotyledons. Localized in a one-cell-wide ring at the boundary between trichomes or lateral roots and epidermis. Accumulates at the boundaries between leaf primordia and the shoot meristem and between floral primordia and the inflorescence meristem. Found in the adaxial axils of secondary inflorescences and pedicels, and in axiallary buds. In flowers, expressed in a ring at the bases of sepals and petals. In carpels, confined to the boundaries between ovule primordia. In ovules, localized in a ring at the boundary between the nucellus and the chalaza. In the mature embryo sac, detected in the two polar nuclei of the central cell. {ECO:0000269\|PubMed:12837947, ECO:0000269\|PubMed:17122068}.
Uniprot	TISSUE SPECIFICITY: In a general manner, present at the boundaries between mersitems and araising primordia. {ECO:0000269\|PubMed:12837947}.

Functional Description ? help Back to Top
Source	Description
TAIR	Identified in an enhancer trap line; member of the NAC family of proteins. Expressed at the boundary between the shoot meristem and lateral organs and the polar nuclei in the embryo sac.
UniProt	Transcription activator. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for axillary meristem initiation and separation of the meristem from the main stem. May act as an inhibitor of cell division. {ECO:0000269\|PubMed:12837947, ECO:0000269\|PubMed:17122068}.

Function -- GeneRIF ? help Back to Top
These results reveal that redundant but partially distinct functions of CUC1, CUC2, and CUC3 are responsible for shoot organ boundary and meristem formation throughout the life cycle in Arabidopsis. [PMID: 17122068] Overexpression of miR164 in the cuc3-2 mutant caused an almost complete block of axillary meristem formation. [PMID: 18346190] CUC2 and CUC3 expression mediated by AHK2 and AHK3 signaling may play roles in regulation of flower development. [PMID: 19913077] CUC2 and CUC3 are expressed in leaf primordia and are required for wild-type serration. [PMID: 21258003] The cuc2 cuc3 double mutant displays irregular phyllotaxis in the mature shoot but not in the shoot apex, thus showing a post-meristematic effect of the mutations on phyllotaxis. [PMID: 25681504] cuc1 grf1/2/3, cuc2 grf1/2/3, and cuc3 grf1/2/3 quadruple mutants showed dramatic increases in cotyledon fusion as well as floral organ fusion. [PMID: 25761011]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00241	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G76420.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. {ECO:0000269\|PubMed:16854978}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source	Upstream Regulator (A: Activate/R: Repress)
ATRM	AT1G62360 (R), AT3G15170 (A), AT5G53950 (A), AT5G61850 (A)

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT1G62360(A), AT5G61850(A)

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	Cytokinin

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G76420

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC012394	0.0	AC012394.3 Arabidopsis thaliana chromosome 1 BAC F15M4 genomic sequence, complete sequence.
GenBank	AC015450	0.0	AC015450.5 Arabidopsis thaliana chromosome 1 BAC F14G6 genomic sequence, complete sequence.
GenBank	AF543194	0.0	AF543194.1 Arabidopsis thaliana cup-shaped cotyledon 3 (CUC3) gene, complete cds.
GenBank	CP002684	0.0	CP002684.1 Arabidopsis thaliana chromosome 1 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_177768.1	0.0	NAC (No Apical Meristem) domain transcriptional regulator superfamily protein
Swissprot	Q9S851	0.0	NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBL	A0A178W1E7	0.0	A0A178W1E7_ARATH; NAC368
STRING	AT1G76420.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM400	28	174
Representative plant	OGRP17	15	800

Link Out ? help Back to Top
Phytozome	AT1G76420.1
Entrez Gene	843975
iHOP	AT1G76420
wikigenes	AT1G76420

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Vroemen CW,Mordhorst AP,Albrecht C,Kwaaitaal MA,de Vries SC The CUP-SHAPED COTYLEDON3 gene is required for boundary and shoot meristem formation in Arabidopsis. Plant Cell, 2003. 15(7): p. 1563-77 [PMID:12837947] Ooka H, et al. Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana. DNA Res., 2003. 10(6): p. 239-47 [PMID:15029955] Laufs P,Peaucelle A,Morin H,Traas J MicroRNA regulation of the CUC genes is required for boundary size control in Arabidopsis meristems. Development, 2004. 131(17): p. 4311-22 [PMID:15294871] Zimmermann R,Werr W Pattern formation in the monocot embryo as revealed by NAM and CUC3 orthologues from Zea mays L. Plant Mol. Biol., 2005. 58(5): p. 669-85 [PMID:16158242] Belles-Boix E, et al. KNAT6: an Arabidopsis homeobox gene involved in meristem activity and organ separation. Plant Cell, 2006. 18(8): p. 1900-7 [PMID:16798887] Kwon CS, et al. A role for chromatin remodeling in regulation of CUC gene expression in the Arabidopsis cotyledon boundary. Development, 2006. 133(16): p. 3223-30 [PMID:16854978] Nikovics K, et al. The balance between the MIR164A and CUC2 genes controls leaf margin serration in Arabidopsis. Plant Cell, 2006. 18(11): p. 2929-45 [PMID:17098808] Hibara K, et al. Arabidopsis CUP-SHAPED COTYLEDON3 regulates postembryonic shoot meristem and organ boundary formation. Plant Cell, 2006. 18(11): p. 2946-57 [PMID:17122068] Raman S, et al. Interplay of miR164, CUP-SHAPED COTYLEDON genes and LATERAL SUPPRESSOR controls axillary meristem formation in Arabidopsis thaliana. Plant J., 2008. 55(1): p. 65-76 [PMID:18346190] Blein T, et al. A conserved molecular framework for compound leaf development. Science, 2008. 322(5909): p. 1835-9 [PMID:19095941] Lee DK,Geisler M,Springer PS LATERAL ORGAN FUSION1 and LATERAL ORGAN FUSION2 function in lateral organ separation and axillary meristem formation in Arabidopsis. Development, 2009. 136(14): p. 2423-32 [PMID:19542355] Li XG, et al. Cytokinin overproduction-caused alteration of flower development is partially mediated by CUC2 and CUC3 in Arabidopsis. Gene, 2010. 450(1-2): p. 109-20 [PMID:19913077] Hasson A, et al. Evolution and diverse roles of the CUP-SHAPED COTYLEDON genes in Arabidopsis leaf development. Plant Cell, 2011. 23(1): p. 54-68 [PMID:21258003] Lie C,Kelsom C,Wu X WOX2 and STIMPY-LIKE/WOX8 promote cotyledon boundary formation in Arabidopsis. Plant J., 2012. 72(4): p. 674-82 [PMID:22827849] Stirnberg P,Liu JP,Ward S,Kendall SL,Leyser O Mutation of the cytosolic ribosomal protein-encoding RPS10B gene affects shoot meristematic function in Arabidopsis. BMC Plant Biol., 2012. 12: p. 160 [PMID:22963533] Pei H, et al. An NAC transcription factor controls ethylene-regulated cell expansion in flower petals. Plant Physiol., 2013. 163(2): p. 775-91 [PMID:23933991] Chen C, et al. Transcriptome profiling reveals roles of meristem regulators and polarity genes during fruit trichome development in cucumber (Cucumis sativus L.). J. Exp. Bot., 2014. 65(17): p. 4943-58 [PMID:24962999] Burian A, et al. The CUP-SHAPED COTYLEDON2 and 3 genes have a post-meristematic effect on Arabidopsis thaliana phyllotaxis. Ann. Bot., 2015. 115(5): p. 807-20 [PMID:25681504] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Lee BH,Jeon JO,Lee MM,Kim JH Genetic interaction between GROWTH-REGULATING FACTOR and CUP-SHAPED COTYLEDON in organ separation. Plant Signal Behav, 2015. 10(2): p. e988071 [PMID:25761011] Huang D, et al. A Gibberellin-Mediated DELLA-NAC Signaling Cascade Regulates Cellulose Synthesis in Rice. Plant Cell, 2015. 27(6): p. 1681-96 [PMID:26002868] Gonçalves B, et al. A conserved role for CUP-SHAPED COTYLEDON genes during ovule development. Plant J., 2015. 83(4): p. 732-42 [PMID:26119568] Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis. Plant J., 2017. 90(3): p. 435-446 [PMID:28161901] Espinosa-Ruiz A, et al. TOPLESS mediates brassinosteroid control of shoot boundaries and root meristem development in Arabidopsis thaliana. Development, 2017. 144(9): p. 1619-1628 [PMID:28320734] Koyama T,Sato F,Ohme-Takagi M Roles of miR319 and TCP Transcription Factors in Leaf Development. Plant Physiol., 2017. 175(2): p. 874-885 [PMID:28842549]