PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm_27.model.AmTr_v1.0_scaffold00019.457 | ||||||||
Common Name | AMTR_s00019p00256850 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 236aa MW: 26991.1 Da PI: 10.1091 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 42.7 | 1.3e-13 | 45 | 91 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W++e d+ ++++v q+G ++W+tIa+ + g +kqc++rw+++l evm_27.model.AmTr_v1.0_scaffold00019.457 45 KGQWSKEGDDMIIELVLQHGAKNWSTIAQALL-GWNGKQCRERWHNHL 91 799****************************9.*************97 PP | |||||||
2 | Myb_DNA-binding | 46.6 | 8e-15 | 97 | 140 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 + +WT+ E++ l++a++q+G++ W + a+ ++ gRt + +k+ w++ evm_27.model.AmTr_v1.0_scaffold00019.457 97 KEAWTPHEELALIRAHQQHGNK-WVKLAKFLP-GRTNNAIKNNWNS 140 579*******************.*********.*********9985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 8.2E-9 | 23 | 51 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 24.041 | 40 | 95 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 5.77E-28 | 42 | 138 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.3E-11 | 44 | 93 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.63E-11 | 48 | 91 | No hit | No description |
Pfam | PF13921 | 1.1E-12 | 48 | 105 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 5.9E-21 | 52 | 98 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 16.068 | 96 | 146 | IPR017930 | Myb domain |
SMART | SM00717 | 3.5E-12 | 96 | 144 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.26E-9 | 99 | 142 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 6.2E-22 | 99 | 146 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 236 aa Download sequence Send to blast |
MAIITRQLLS IPLYAAMQHD TFFTYRTEVQ CYHRWHKVLN PDLVKGQWSK EGDDMIIELV 60 LQHGAKNWST IAQALLGWNG KQCRERWHNH LNPAIHKEAW TPHEELALIR AHQQHGNKWV 120 KLAKFLPGRT NNAIKNNWNS SLKKKLASYA GSGLLGQFPG YLLWTQLSHV SHLSLLHGIN 180 QPWGMTVSRM ELEWIICQNV VKNQFQLGAS NLNIVADTSV PAIHDASELK LTRRM* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h88_C | 7e-49 | 22 | 146 | 35 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 7e-49 | 22 | 146 | 35 | 159 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds 5'-AACGG-3' motifs in gene promoters (PubMed:21862669). Involved in the regulation of cytokinesis, probably via the activation of several G2/M phase-specific genes transcription (e.g. KNOLLE) (PubMed:17287251, PubMed:21862669, PubMed:25806785). Required for the maintenance of diploidy (PubMed:21862669). {ECO:0000269|PubMed:17287251, ECO:0000269|PubMed:21862669, ECO:0000269|PubMed:25806785}.; FUNCTION: Involved in transcription regulation during induced endoreduplication at the powdery mildew (e.g. G.orontii) infection site, thus promoting G.orontii growth and reproduction. {ECO:0000269|PubMed:20018666}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly induced by salicylic acid (SA) (PubMed:16463103). Expressed in a cell cycle-dependent manner, with highest levels 2 hours before the peak of mitotic index in cells synchronized by aphidicolin. Activated by CYCB1 (PubMed:17287251). Accumulates at powdery mildew (e.g. G.orontii) infected cells. {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:17287251}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020523603.1 | 1e-105 | transcription factor MYB115 isoform X1 | ||||
Swissprot | Q94FL9 | 4e-61 | MB3R4_ARATH; Transcription factor MYB3R-4 | ||||
TrEMBL | W1PID6 | 1e-174 | W1PID6_AMBTC; Uncharacterized protein | ||||
STRING | ERN07489 | 1e-175 | (Amborella trichopoda) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G11510.2 | 2e-55 | myb domain protein 3r-4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm_27.model.AmTr_v1.0_scaffold00019.457 |
Publications ? help Back to Top | |||
---|---|---|---|
|