PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm_27.model.AmTr_v1.0_scaffold00016.178 | ||||||||
Common Name | AMTR_s00016p00207840 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 170aa MW: 18302.9 Da PI: 8.4909 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 173.3 | 1.9e-53 | 18 | 161 | 1 | 151 |
GRAS 1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppset 69 lv+lLl+cAeav+++d +a+++L +ls asp gd+mqR+a+yf+ AL+arl+ +p+++ evm_27.model.AmTr_v1.0_scaffold00016.178 18 LVHLLLACAEAVAKEDYPAAHRCLLHLSRAASPLGDSMQRVASYFADALSARLSP-------PPSPQPQ 79 68****************************************************9.......5667777 PP GRAS 70 seknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpeg 138 + + +e l++++++++++P++kf+h+taN+aI ea+++e+rvH+iD+di qG QWpa+lqaLa Rp+g evm_27.model.AmTr_v1.0_scaffold00016.178 80 PVAHPAELLKIYQILYQACPYIKFAHFTANHAIFEAFASETRVHVIDLDILQGYQWPAFLQALAGRPGG 148 777899*************************************************************** PP GRAS 139 ppslRiTgvgspe 151 pp lR+Tg ++++ evm_27.model.AmTr_v1.0_scaffold00016.178 149 PPALRLTGKVHKT 161 ********88855 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50985 | 35.338 | 1 | 169 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 6.4E-51 | 18 | 161 | IPR005202 | Transcription factor GRAS |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 170 aa Download sequence Send to blast |
MNGGGGEGSG SHDSGLQLVH LLLACAEAVA KEDYPAAHRC LLHLSRAASP LGDSMQRVAS 60 YFADALSARL SPPPSPQPQP VAHPAELLKI YQILYQACPY IKFAHFTANH AIFEAFASET 120 RVHVIDLDIL QGYQWPAFLQ ALAGRPGGPP ALRLTGKVHK TLRQQFSRQ* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5b3g_A | 2e-37 | 25 | 156 | 26 | 164 | Protein SCARECROW |
5b3h_A | 2e-37 | 25 | 156 | 25 | 163 | Protein SCARECROW |
5b3h_D | 2e-37 | 25 | 156 | 25 | 163 | Protein SCARECROW |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that functions in mycorrhizal specific signaling (PubMed:23122845). Required for Myc factor signaling from mycorrhizal fungi, but has no function in Nod factor signaling from rhizobial bacteria (PubMed:23122845). Regulates the expression of RAM2, a glycerol-3-phosphate acyl transferase that promotes cutin biosynthesis to enhance mycorrhizal hyphopodia formation (PubMed:23122845). {ECO:0000269|PubMed:23122845}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced in roots during colonization by arbuscular mycorrhizal fungi. {ECO:0000269|PubMed:23122845}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020523030.1 | 1e-118 | DELLA protein RGL1 | ||||
Swissprot | G7L166 | 4e-61 | RAM1_MEDTR; GRAS family protein RAM1 | ||||
TrEMBL | W1PGQ3 | 1e-120 | W1PGQ3_AMBTC; Uncharacterized protein | ||||
STRING | ERN06265 | 1e-121 | (Amborella trichopoda) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5366 | 13 | 22 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G14920.1 | 7e-38 | GRAS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm_27.model.AmTr_v1.0_scaffold00016.178 |
Publications ? help Back to Top | |||
---|---|---|---|
|