PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT1G71030.1

Common Name

ATMYBL2, F23N20.2, MYBL2

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB_related

Protein Properties

Length: 195aa MW: 22098.1 Da PI: 10.4105

Description

MYB-like 2

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G71030.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	49.3	1.2e-15	37	80	3	48
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +++++Ed+l+++++++lG++ W++Ia +++ gRt+++++ +w +yl AT1G71030.1 37 NFSKDEDDLILKLHALLGNR-WSLIAGRLP-GRTDNEVRIHWETYL 80 79****************.*****.**********997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	1.9E-18	17	90	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	8.0E-4	18	42	IPR009057	Homeodomain-like
PROSITE profile	PS51294	24.468	30	84	IPR017930	Myb domain
SMART	SM00717	5.2E-15	34	82	IPR001005	SANT/Myb domain
Pfam	PF00249	1.9E-14	37	80	IPR001005	SANT/Myb domain
CDD	cd00167	2.68E-12	37	80	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.6E-19	43	81	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0009651	Biological Process	response to salt stress
GO:0009718	Biological Process	anthocyanin-containing compound biosynthetic process
GO:0009723	Biological Process	response to ethylene
GO:0009737	Biological Process	response to abscisic acid
GO:0009739	Biological Process	response to gibberellin
GO:0009751	Biological Process	response to salicylic acid
GO:0009753	Biological Process	response to jasmonic acid
GO:0010023	Biological Process	proanthocyanidin biosynthetic process
GO:0030154	Biological Process	cell differentiation
GO:0046686	Biological Process	response to cadmium ion
GO:0005634	Cellular Component	nucleus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009049	anatomy	inflorescence
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0001380	developmental stage	sepals enclosing flower bud stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 195 aa Download sequence Send to blast
MNKTRLRALS PPSGMQHRKR CRLRGRNYVR PEVKQRNFSK DEDDLILKLH ALLGNRWSLI 60 AGRLPGRTDN EVRIHWETYL KRKLVKMGID PTNHRLHHHT NYISRRHLHS SHKEHETKII 120 SDQSSSVSES CGVTILPIPS TNCSEDSTST GRSHLPDLNI GLIPAVTSLP ALCLQDSSES 180 STNGSTGQET LLLFR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	3e-17	19	84	43	108	B-MYB
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.20981	0.0	bud\| flower\| inflorescence\| root\| silique

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	30698771	0.0
Genevisible	259751_at	0.0
Expression Atlas	AT1G71030	-
AtGenExpress	AT1G71030	-
ATTED-II	AT1G71030	-

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a putative myb family transcription factor. In contrast to most other myb-like proteins its myb domain consists of a single repeat. A proline-rich region potentially involved in transactivation is found in the C-terminal part of the protein. Its transcript accumulates mainly in leaves.

Function -- GeneRIF ? help Back to Top
AtMYBL2 acts as a transcriptional repressor and negatively regulates the biosynthesis of anthocyanin. [PMID: 18532977] MYBL2 interacts with basic helix-loop-helix proteins to regulate anthocyanin biosynthesis. [PMID: 18532978] MYBL2 is a substrate of GSK3-like kinase BIN2 and acts as a corepressor of BES1 in brassinosteroid signaling pathway in Arabidopsis. [PMID: 23169658] While BIN2 phosphorylates and destabilizes BES1/BZR1, BIN2 phosphorylated MYBL2 and HAT1 appear to be stabilized. [PMID: 24526246] This study showed that HY5 directly binds to the MYBD promoter and that although MYBD and MYBH are homologs, they act in opposite ways during plant photomorphogenesis. [PMID: 26576746] Repression of MYBL2 by Both microRNA858a and HY5 Leads to the Activation of Anthocyanin Biosynthetic Pathway in Arabidopsis [PMID: 27450422]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G71030.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source	Upstream Regulator (A: Activate/R: Repress)
ATRM	AT1G63650 (A), AT3G13540 (A), AT4G09820 (A)

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT1G56650(R), AT1G63650(R), AT1G79840(R), AT4G09820(R), AT5G35550(R), AT5G42800(R)

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	abscisic acid, ethylene, gibberellin, jasmonic acid, salicylic acid

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G71030

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF370609	0.0	AF370609.1 Arabidopsis thaliana putative transcription factor (F23N20.2) mRNA, complete cds.
GenBank	AY048231	0.0	AY048231.1 Arabidopsis thaliana At1g71030/F23N20_2 mRNA, complete cds.
GenBank	AY087093	0.0	AY087093.1 Arabidopsis thaliana clone 31592 mRNA, complete sequence.
GenBank	AY091697	0.0	AY091697.1 Arabidopsis thaliana At1g71030/F23N20_2 mRNA, complete cds.
GenBank	AY519519	0.0	AY519519.1 Arabidopsis thaliana MYB transcription factor (At1g71030) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_177259.1	1e-142	MYB-like 2
TrEMBL	Q9C9A5	1e-140	Q9C9A5_ARATH; At1g71030/F23N20_2
STRING	AT1G71030.1	1e-141	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Link Out ? help Back to Top
Phytozome	AT1G71030.1
Entrez Gene	843443
iHOP	AT1G71030
wikigenes	AT1G71030

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Sawa S Overexpression of the AtmybL2 gene represses trichome development in Arabidopsis. DNA Res., 2002. 9(2): p. 31-4 [PMID:12056412] Wu XM,Lim SH,Yang WC Characterization, expression and phylogenetic study of R2R3-MYB genes in orchid. Plant Mol. Biol., 2003. 51(6): p. 959-72 [PMID:12777054] Vlieghe K, et al. Microarray analysis of E2Fa-DPa-overexpressing plants uncovers a cross-talking genetic network between DNA replication and nitrogen assimilation. J. Cell. Sci., 2003. 116(Pt 20): p. 4249-59 [PMID:12953064] Folta KM,Pontin MA,Karlin-Neumann G,Bottini R,Spalding EP Genomic and physiological studies of early cryptochrome 1 action demonstrate roles for auxin and gibberellin in the control of hypocotyl growth by blue light. Plant J., 2003. 36(2): p. 203-14 [PMID:14535885] Rizhsky L,Davletova S,Liang H,Mittler R The zinc finger protein Zat12 is required for cytosolic ascorbate peroxidase 1 expression during oxidative stress in Arabidopsis. J. Biol. Chem., 2004. 279(12): p. 11736-43 [PMID:14722088] Goda H, et al. Comprehensive comparison of auxin-regulated and brassinosteroid-regulated genes in Arabidopsis. Plant Physiol., 2004. 134(4): p. 1555-73 [PMID:15047898] Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes. Plant J., 2004. 38(2): p. 366-79 [PMID:15078338] Ko JH,Han KH,Park S,Yang J Plant body weight-induced secondary growth in Arabidopsis and its transcription phenotype revealed by whole-transcriptome profiling. Plant Physiol., 2004. 135(2): p. 1069-83 [PMID:15194820] Cornah JE,Germain V,Ward JL,Beale MH,Smith SM Lipid utilization, gluconeogenesis, and seedling growth in Arabidopsis mutants lacking the glyoxylate cycle enzyme malate synthase. J. Biol. Chem., 2004. 279(41): p. 42916-23 [PMID:15272001] He JX, et al. BZR1 is a transcriptional repressor with dual roles in brassinosteroid homeostasis and growth responses. Science, 2005. 307(5715): p. 1634-8 [PMID:15681342] Vergnolle C, et al. The cold-induced early activation of phospholipase C and D pathways determines the response of two distinct clusters of genes in Arabidopsis cell suspensions. Plant Physiol., 2005. 139(3): p. 1217-33 [PMID:16258011] Nakamura A, et al. Arabidopsis Aux/IAA genes are involved in brassinosteroid-mediated growth responses in a manner dependent on organ type. Plant J., 2006. 45(2): p. 193-205 [PMID:16367964] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Osuna D, et al. Temporal responses of transcripts, enzyme activities and metabolites after adding sucrose to carbon-deprived Arabidopsis seedlings. Plant J., 2007. 49(3): p. 463-91 [PMID:17217462] Broekgaarden C, et al. Genotypic variation in genome-wide transcription profiles induced by insect feeding: Brassica oleracea--Pieris rapae interactions. BMC Genomics, 2007. 8: p. 239 [PMID:17640338] Usadel B, et al. Global transcript levels respond to small changes of the carbon status during progressive exhaustion of carbohydrates in Arabidopsis rosettes. Plant Physiol., 2008. 146(4): p. 1834-61 [PMID:18305208] Matsui K,Umemura Y,Ohme-Takagi M AtMYBL2, a protein with a single MYB domain, acts as a negative regulator of anthocyanin biosynthesis in Arabidopsis. Plant J., 2008. 55(6): p. 954-67 [PMID:18532977] Dubos C, et al. MYBL2 is a new regulator of flavonoid biosynthesis in Arabidopsis thaliana. Plant J., 2008. 55(6): p. 940-53 [PMID:18532978] Ascencio-Ib Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] Agudelo-Romero P, et al. Changes in the gene expression profile of Arabidopsis thaliana after infection with Tobacco etch virus. Virol. J., 2008. 5: p. 92 [PMID:18684336] Jakoby MJ, et al. Transcriptional profiling of mature Arabidopsis trichomes reveals that NOECK encodes the MIXTA-like transcriptional regulator MYB106. Plant Physiol., 2008. 148(3): p. 1583-602 [PMID:18805951] Li SF, et al. The Arabidopsis MYB5 transcription factor regulates mucilage synthesis, seed coat development, and trichome morphogenesis. Plant Cell, 2009. 21(1): p. 72-89 [PMID:19136646] Rowan DD, et al. Environmental regulation of leaf colour in red 35S:PAP1 Arabidopsis thaliana. New Phytol., 2009. 182(1): p. 102-15 [PMID:19192188] Arsovski AA,Villota MM,Rowland O,Subramaniam R,Western TL MUM ENHANCERS are important for seed coat mucilage production and mucilage secretory cell differentiation in Arabidopsis thaliana. J. Exp. Bot., 2009. 60(9): p. 2601-12 [PMID:19401413] Feyissa DN,Løvdal T,Olsen KM,Slimestad R,Lillo C The endogenous GL3, but not EGL3, gene is necessary for anthocyanin accumulation as induced by nitrogen depletion in Arabidopsis rosette stage leaves. Planta, 2009. 230(4): p. 747-54 [PMID:19621239] Jeong SW, et al. Ethylene suppression of sugar-induced anthocyanin pigmentation in Arabidopsis. Plant Physiol., 2010. 154(3): p. 1514-31 [PMID:20876338] Th A new system for fast and quantitative analysis of heterologous gene expression in plants. New Phytol., 2012. 193(2): p. 504-12 [PMID:22023451] Causier B,Ashworth M,Guo W,Davies B The TOPLESS interactome: a framework for gene repression in Arabidopsis. Plant Physiol., 2012. 158(1): p. 423-38 [PMID:22065421] Ye H,Li L,Guo H,Yin Y MYBL2 is a substrate of GSK3-like kinase BIN2 and acts as a corepressor of BES1 in brassinosteroid signaling pathway in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2012. 109(49): p. 20142-7 [PMID:23169658] Li S,Zachgo S TCP3 interacts with R2R3-MYB proteins, promotes flavonoid biosynthesis and negatively regulates the auxin response in Arabidopsis thaliana. Plant J., 2013. 76(6): p. 901-13 [PMID:24118612] Zhang D, et al. Transcription factors involved in brassinosteroid repressed gene expression and their regulation by BIN2 kinase. Plant Signal Behav, 2014. 9(1): p. e27849 [PMID:24526246] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Wang Y,Wang Y,Song Z,Zhang H Repression of MYBL2 by Both microRNA858a and HY5 Leads to the Activation of Anthocyanin Biosynthetic Pathway in Arabidopsis. Mol Plant, 2016. 9(10): p. 1395-1405 [PMID:27450422] Kirik V,B A novel leaf-specific myb-related protein with a single binding repeat. Gene, 1996. 183(1-2): p. 109-13 [PMID:8996094]