PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT1G56650.1

Common Name

ATMYB75, F25P12.92, MYB75, PAP1, SIAA1

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 248aa MW: 28469.7 Da PI: 9.4398

Description

production of anthocyanin pigment 1

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G56650.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	55.1	1.8e-17	10	57	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WTteEd ll ++++++G g W+ ++ + g++R++k+c++rw++yl AT1G56650.1 10 KGAWTTEEDSLLRQCINKYGEGKWHQVPVRAGLNRCRKSCRLRWLNYL 57 79********************************************97 PP
2	Myb_DNA-binding	47.7	3.7e-15	63	108	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + +E +ll++++++lG++ W++Ia +++ gRt++++k++w+++l AT1G56650.1 63 RGKLSSDEVDLLLRLHRLLGNR-WSLIAGRLP-GRTANDVKNYWNTHL 108 78999***************.*****.**********996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.1E-21	5	60	IPR009057	Homeodomain-like
PROSITE profile	PS51294	18.07	5	57	IPR017930	Myb domain
SuperFamily	SSF46689	7.42E-28	7	104	IPR009057	Homeodomain-like
SMART	SM00717	7.0E-15	9	59	IPR001005	SANT/Myb domain
Pfam	PF00249	6.6E-16	10	57	IPR001005	SANT/Myb domain
CDD	cd00167	1.31E-10	12	57	No hit	No description
PROSITE profile	PS51294	24.821	58	112	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	5.3E-22	61	111	IPR009057	Homeodomain-like
SMART	SM00717	2.9E-14	62	110	IPR001005	SANT/Myb domain
Pfam	PF00249	7.9E-14	63	108	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0009651	Biological Process	response to salt stress
GO:0009723	Biological Process	response to ethylene
GO:0009733	Biological Process	response to auxin
GO:0009745	Biological Process	sucrose mediated signaling
GO:0009753	Biological Process	response to jasmonic acid
GO:0019430	Biological Process	removal of superoxide radicals
GO:0030154	Biological Process	cell differentiation
GO:0031540	Biological Process	regulation of anthocyanin biosynthetic process
GO:0050832	Biological Process	defense response to fungus
GO:0005634	Cellular Component	nucleus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0005515	Molecular Function	protein binding
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000037	anatomy	shoot apex
PO:0000293	anatomy	guard cell
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009025	anatomy	vascular leaf
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009047	anatomy	stem
PO:0020100	anatomy	hypocotyl
PO:0025281	anatomy	pollen
PO:0001185	developmental stage	plant embryo globular stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 248 aa Download sequence Send to blast
MEGSSKGLRK GAWTTEEDSL LRQCINKYGE GKWHQVPVRA GLNRCRKSCR LRWLNYLKPS 60 IKRGKLSSDE VDLLLRLHRL LGNRWSLIAG RLPGRTANDV KNYWNTHLSK KHEPCCKIKM 120 KKRDITPIPT TPALKNNVYK PRPRSFTVNN DCNHLNAPPK VDVNPPCLGL NINNVCDNSI 180 IYNKDKKKDQ LVNNLIDGDN MWLEKFLEES QEVDILVPEA TTTEKGDTLA FDVDQLWSLF 240 DGETVKFD

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	2e-21	8	111	5	107	B-MYB
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	3941507	0.0
Genevisible	245628_at	0.0
Expression Atlas	AT1G56650	-
AtGenExpress	AT1G56650	-
ATTED-II	AT1G56650	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Mostly expressed in mature plant aerial part. Detected ubiquitously, with higher levels in rosette leaves and flowers. {ECO:0000269\|PubMed:17147621, ECO:0000269\|PubMed:9839469}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a putative MYB domain containing transcription factor involved in anthocyanin metabolism and radical scavenging. Essential for the sucrose-mediated expression of the dihydroflavonol reductase gene.
UniProt	Transcription activator, when associated with BHLH12/MYC1, EGL3, or GL3. Promotes the synthesis of. phenylpropanoid-derived compounds such as anthocyanins and proanthocyanidin, probably together with GL3 and BHLH2. Regulates the expression of CHS, DFRA, LDOX, and BAN. {ECO:0000269\|PubMed:11148285, ECO:0000269\|PubMed:12917293, ECO:0000269\|PubMed:15361138, ECO:0000269\|PubMed:15807784, ECO:0000269\|PubMed:16299184, ECO:0000269\|PubMed:17147621}.

Function -- GeneRIF ? help Back to Top
Two putative glycosyltransferase genes (At5g17050 and At4g14090) induced by PAP1 expression were confirmed to encode flavonoid 3-O-glucosyltransferase and anthocyanin 5-O-glucosyltransferase, respectively. [PMID: 15807784] High-temperature, low-light (HTLL) treatment of 35S:PAP1 Arabidopsis thaliana over-expressing the PAP1 (Production of Anthocyanin Pigment 1) gene results in reversible reduction of red colouration. [PMID: 19192188] In the same light intensity condition, the responses of anthocyanin levels and profiling to medium alternation were different between pap1-D and wild type plants. [PMID: 20309578] MYB75 is nuclear localized and acts as a transcriptional activator. Loss of MYB75 function affects secondary cell wall structure and composition. [PMID: 20807862] Data indicate that miR828, TAS4-siRNA81(-), and its targets MYB transcription factors PAP1 and PAP2 are responsive to sucrose. [PMID: 21533841] Nitrogen regulation of anthocyanin biosynthesis in Arabidopsis thaliana red cells undergoes a mechanism by which nitrogen controls the expression of genes encoding both main components of the TTG1-GL3/TT8-PAP1 complex and negative regulators. [PMID: 22669605] Cytokinins enhance anthocyanin content and transcript levels of sugar inducible structural gene UDPglucose: flavonoid 3-O-glucosyl transferase and regulatory gene PRODUCTION OF ANTHOCYANIN PIGMENT 1. [PMID: 22699753] The COP1/SPA complex affects PAP1 and PAP2 both transcriptionally and post-translationally. The COP1/SPA complex controls anthocyanin levels in Arabidopsis. [PMID: 23425305] Bifurcate regulation of anthocyanin biosynthesis by HY5 via transcriptional activation of PAP1. [PMID: 23583450] The quantity and diversity of flavonoids is increased by overexpressing MYB12/PAP1. Flavonoids enhances both biotic and abiotic stress tolerance in crops. [PMID: 24274116] the production of anthocyanin pigment 1 (AtPAP1) transcription factor from Arabidopsis thaliana induces anthocyanin production in transgenic Taraxacum brevicorniculatum.[AtPAP1] [PMID: 24556963] Performance of a specialist aphid (Brevicoryne brassicae) was unaffected after feeding on oxMYB75 plants, whereas a specialist caterpillar (Pieris brassicae) gained significantly higher body mass when feeding on this plant. [PMID: 24619996] Flowers of 35S:PAP1 transgenic plants produced the same or even higher levels of volatiles when exposed to a long-term high-temperature regime. [PMID: 25402319] This work lays the foundation for dissecting the sucrose signaling pathway of PAP1 and contributes to understanding the interplay between sucrose signaling, anthocyanin biosynthesis, and stress responses [PMID: 27248141] double mutant plants that harbor fls1kknock out in the pap1-D background (i.e., pap1-D/fls1ko plants) were generated, to examine whether anthocyanins can be further enhanced by blocking flavonol biosynthesis under PAP1 overexpression. [PMID: 27562381] Data show that MPK4 phosphorylation of MYB75 increases its stability and is essential for light-induced anthocyanin accumulation. Our findings reveal an important role for a MAPK pathway in light signal transduction. [PMID: 27811015] DRB3 negatively regulates anthocyanin biosynthesis by modulating the level of PAP1 transcript. [PMID: 27995376]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G56650.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By jasmonic acid (JA), NaCl, sucrose, UV light, nitrogen deficiency and drought. {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:17053893, ECO:0000269\|PubMed:9839469}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source	Upstream Regulator (A: Activate/R: Repress)
ATRM	AT1G71030 (R), AT1G78600 (A)

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT1G03940(A), AT1G22640(A), AT1G66390(A), AT2G23000(R), AT2G37260(A), AT3G29590(A), AT3G55120(A), AT4G09820(A), AT4G14090(A), AT5G13930(A), AT5G17050(A), AT5G17220(A), AT5G42800(A), AT5G54060(A)

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	jasmonic acid

Interaction -- BIND ? help Back to Top
Source	Intact With	Description
BIND	AT1G63650	EGL3 interacts with PAP1.

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT1G62990, AT1G63650
IntAct	Search Q9FE25

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G56650

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK221639	0.0	AK221639.1 Arabidopsis thaliana mRNA for transcription factor, complete cds, clone: RAFL07-99-A21.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_176057.1	0.0	production of anthocyanin pigment 1
Swissprot	Q9FE25	0.0	MYB75_ARATH; Transcription factor MYB75
TrEMBL	A0A178WGN5	1e-169	A0A178WGN5_ARATH; SIAA1
STRING	AT1G56650.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646
Representative plant	OGRP5	17	1784

Link Out ? help Back to Top
Phytozome	AT1G56650.1
Entrez Gene	842120
iHOP	AT1G56650
wikigenes	AT1G56650

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Borevitz JO,Xia Y,Blount J,Dixon RA,Lamb C Activation tagging identifies a conserved MYB regulator of phenylpropanoid biosynthesis. Plant Cell, 2000. 12(12): p. 2383-2394 [PMID:11148285] Stracke R,Werber M,Weisshaar B The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] Hiratsu K,Matsui K,Koyama T,Ohme-Takagi M Dominant repression of target genes by chimeric repressors that include the EAR motif, a repression domain, in Arabidopsis. Plant J., 2003. 34(5): p. 733-9 [PMID:12787253] Zhang F,Gonzalez A,Zhao M,Payne CT,Lloyd A A network of redundant bHLH proteins functions in all TTG1-dependent pathways of Arabidopsis. Development, 2003. 130(20): p. 4859-69 [PMID:12917293] Zimmermann IM,Heim MA,Weisshaar B,Uhrig JF Comprehensive identification of Arabidopsis thaliana MYB transcription factors interacting with R/B-like BHLH proteins. Plant J., 2004. 40(1): p. 22-34 [PMID:15361138] Tohge T, et al. Functional genomics by integrated analysis of metabolome and transcriptome of Arabidopsis plants over-expressing an MYB transcription factor. Plant J., 2005. 42(2): p. 218-35 [PMID:15807784] Tohge T,Matsui K,Ohme-Takagi M,Yamazaki M,Saito K Enhanced radical scavenging activity of genetically modified Arabidopsis seeds. Biotechnol. Lett., 2005. 27(5): p. 297-303 [PMID:15834789] Tokimatsu T, et al. KaPPA-view: a web-based analysis tool for integration of transcript and metabolite data on plant metabolic pathway maps. Plant Physiol., 2005. 138(3): p. 1289-300 [PMID:16010003] Sharma SB,Dixon RA Metabolic engineering of proanthocyanidins by ectopic expression of transcription factors in Arabidopsis thaliana. Plant J., 2005. 44(1): p. 62-75 [PMID:16167896] Teng S,Keurentjes J,Bentsink L,Koornneef M,Smeekens S Sucrose-specific induction of anthocyanin biosynthesis in Arabidopsis requires the MYB75/PAP1 gene. Plant Physiol., 2005. 139(4): p. 1840-52 [PMID:16299184] Solfanelli C,Poggi A,Loreti E,Alpi A,Perata P Sucrose-specific induction of the anthocyanin biosynthetic pathway in Arabidopsis. Plant Physiol., 2006. 140(2): p. 637-46 [PMID:16384906] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Xie DY,Sharma SB,Wright E,Wang ZY,Dixon RA Metabolic engineering of proanthocyanidins through co-expression of anthocyanidin reductase and the PAP1 MYB transcription factor. Plant J., 2006. 45(6): p. 895-907 [PMID:16507081] Pourtau N,Jennings R,Pelzer E,Pallas J,Wingler A Effect of sugar-induced senescence on gene expression and implications for the regulation of senescence in Arabidopsis. Planta, 2006. 224(3): p. 556-68 [PMID:16514542] G A novel R2R3 MYB transcription factor NtMYBJS1 is a methyl jasmonate-dependent regulator of phenylpropanoid-conjugate biosynthesis in tobacco. Plant J., 2006. 46(4): p. 573-92 [PMID:16640595] Baudry A,Caboche M,Lepiniec L TT8 controls its own expression in a feedback regulation involving TTG1 and homologous MYB and bHLH factors, allowing a strong and cell-specific accumulation of flavonoids in Arabidopsis thaliana. Plant J., 2006. 46(5): p. 768-79 [PMID:16709193] Matousek J, et al. Sequence analysis of a "true" chalcone synthase (chs_H1) oligofamily from hop (Humulus lupulus L.) and PAP1 activation of chs_H1 in heterologous systems. J. Agric. Food Chem., 2006. 54(20): p. 7606-15 [PMID:17002429] Lea US,Slimestad R,Smedvig P,Lillo C Nitrogen deficiency enhances expression of specific MYB and bHLH transcription factors and accumulation of end products in the flavonoid pathway. Planta, 2007. 225(5): p. 1245-53 [PMID:17053893] Matsui K,Tanaka H,Ohme-Takagi M Suppression of the biosynthesis of proanthocyanidin in Arabidopsis by a chimeric PAP1 repressor. Plant Biotechnol. J., 2004. 2(6): p. 487-93 [PMID:17147621] Espley RV, et al. Red colouration in apple fruit is due to the activity of the MYB transcription factor, MdMYB10. Plant J., 2007. 49(3): p. 414-27 [PMID:17181777] Fraser CM, et al. Related Arabidopsis serine carboxypeptidase-like sinapoylglucose acyltransferases display distinct but overlapping substrate specificities. Plant Physiol., 2007. 144(4): p. 1986-99 [PMID:17600138] Cominelli E, et al. Expression analysis of anthocyanin regulatory genes in response to different light qualities in Arabidopsis thaliana. J. Plant Physiol., 2008. 165(8): p. 886-94 [PMID:17766004] Ishida T, et al. Arabidopsis TRANSPARENT TESTA GLABRA2 is directly regulated by R2R3 MYB transcription factors and is involved in regulation of GLABRA2 transcription in epidermal differentiation. Plant Cell, 2007. 19(8): p. 2531-43 [PMID:17766401] Lillo C,Lea US,Ruoff P Nutrient depletion as a key factor for manipulating gene expression and product formation in different branches of the flavonoid pathway. Plant Cell Environ., 2008. 31(5): p. 587-601 [PMID:18031469] Gonzalez A,Zhao M,Leavitt JM,Lloyd AM Regulation of the anthocyanin biosynthetic pathway by the TTG1/bHLH/Myb transcriptional complex in Arabidopsis seedlings. Plant J., 2008. 53(5): p. 814-27 [PMID:18036197] Gao P,Xin Z,Zheng ZL The OSU1/QUA2/TSD2-encoded putative methyltransferase is a critical modulator of carbon and nitrogen nutrient balance response in Arabidopsis. PLoS ONE, 2008. 3(1): p. e1387 [PMID:18167546] Chang CS, et al. LZF1, a HY5-regulated transcriptional factor, functions in Arabidopsis de-etiolation. Plant J., 2008. 54(2): p. 205-19 [PMID:18182030] Ben Zvi MM, et al. Interlinking showy traits: co-engineering of scent and colour biosynthesis in flowers. Plant Biotechnol. J., 2008. 6(4): p. 403-15 [PMID:18346094] Matsui K,Umemura Y,Ohme-Takagi M AtMYBL2, a protein with a single MYB domain, acts as a negative regulator of anthocyanin biosynthesis in Arabidopsis. Plant J., 2008. 55(6): p. 954-67 [PMID:18532977] Dubos C, et al. MYBL2 is a new regulator of flavonoid biosynthesis in Arabidopsis thaliana. Plant J., 2008. 55(6): p. 940-53 [PMID:18532978] Loreti E, et al. Gibberellins, jasmonate and abscisic acid modulate the sucrose-induced expression of anthocyanin biosynthetic genes in Arabidopsis. New Phytol., 2008. 179(4): p. 1004-16 [PMID:18537890] Dare AP,Schaffer RJ,Lin-Wang K,Allan AC,Hellens RP Identification of a cis-regulatory element by transient analysis of co-ordinately regulated genes. Plant Methods, 2008. 4: p. 17 [PMID:18601751] Ascencio-Ib Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] Zhou LL,Zeng HN,Shi MZ,Xie DY Development of tobacco callus cultures over expressing Arabidopsis PAP1/MYB75 transcription factor and characterization of anthocyanin biosynthesis. Planta, 2008. 229(1): p. 37-51 [PMID:18766373] Olsen KM, et al. Temperature and nitrogen effects on regulators and products of the flavonoid pathway: experimental and kinetic model studies. Plant Cell Environ., 2009. 32(3): p. 286-99 [PMID:19054348] Rowan DD, et al. Environmental regulation of leaf colour in red 35S:PAP1 Arabidopsis thaliana. New Phytol., 2009. 182(1): p. 102-15 [PMID:19192188] Peel GJ,Pang Y,Modolo LV,Dixon RA The LAP1 MYB transcription factor orchestrates anthocyanidin biosynthesis and glycosylation in Medicago. Plant J., 2009. 59(1): p. 136-49 [PMID:19368693] Pan Y, et al. Cytochrome P450 monooxygenases as reporters for circadian-regulated pathways. Plant Physiol., 2009. 150(2): p. 858-78 [PMID:19386812] Hugueney P, et al. A novel cation-dependent O-methyltransferase involved in anthocyanin methylation in grapevine. Plant Physiol., 2009. 150(4): p. 2057-70 [PMID:19525322] Shan X,Zhang Y,Peng W,Wang Z,Xie D Molecular mechanism for jasmonate-induction of anthocyanin accumulation in Arabidopsis. J. Exp. Bot., 2009. 60(13): p. 3849-60 [PMID:19596700] Feyissa DN,Løvdal T,Olsen KM,Slimestad R,Lillo C The endogenous GL3, but not EGL3, gene is necessary for anthocyanin accumulation as induced by nitrogen depletion in Arabidopsis rosette stage leaves. Planta, 2009. 230(4): p. 747-54 [PMID:19621239] Zhu HF,Fitzsimmons K,Khandelwal A,Kranz RG CPC, a single-repeat R3 MYB, is a negative regulator of anthocyanin biosynthesis in Arabidopsis. Mol Plant, 2009. 2(4): p. 790-802 [PMID:19825656] Hsieh LC, et al. Uncovering small RNA-mediated responses to phosphate deficiency in Arabidopsis by deep sequencing. Plant Physiol., 2009. 151(4): p. 2120-32 [PMID:19854858] Rubin G,Tohge T,Matsuda F,Saito K,Scheible WR Members of the LBD family of transcription factors repress anthocyanin synthesis and affect additional nitrogen responses in Arabidopsis. Plant Cell, 2009. 21(11): p. 3567-84 [PMID:19933203] Li X,Gao MJ,Pan HY,Cui DJ,Gruber MY Purple canola: Arabidopsis PAP1 increases antioxidants and phenolics in Brassica napus leaves. J. Agric. Food Chem., 2010. 58(3): p. 1639-45 [PMID:20073469] Shi MZ,Xie DY Features of anthocyanin biosynthesis in pap1-D and wild-type Arabidopsis thaliana plants grown in different light intensity and culture media conditions. Planta, 2010. 231(6): p. 1385-400 [PMID:20309578] Pantelides IS,Tjamos SE,Paplomatas EJ Ethylene perception via ETR1 is required in Arabidopsis infection by Verticillium dahliae. Mol. Plant Pathol., 2010. 11(2): p. 191-202 [PMID:20447269] Kwon Y, et al. The ethylene signaling pathway has a negative impact on sucrose-induced anthocyanin accumulation in Arabidopsis. J. Plant Res., 2011. 124(1): p. 193-200 [PMID:20514508] Hanada K, et al. Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana. Mol. Biol. Evol., 2011. 28(1): p. 377-82 [PMID:20736450] Bhargava A,Mansfield SD,Hall HC,Douglas CJ,Ellis BE MYB75 functions in regulation of secondary cell wall formation in the Arabidopsis inflorescence stem. Plant Physiol., 2010. 154(3): p. 1428-38 [PMID:20807862] Jeong SW, et al. Ethylene suppression of sugar-induced anthocyanin pigmentation in Arabidopsis. Plant Physiol., 2010. 154(3): p. 1514-31 [PMID:20876338] Zhang Y,Yan YP,Wang ZZ The Arabidopsis PAP1 transcription factor plays an important role in the enrichment of phenolic acids in Salvia miltiorrhiza. J. Agric. Food Chem., 2010. 58(23): p. 12168-75 [PMID:21058651] Shi MZ,Xie DY Engineering of red cells of Arabidopsis thaliana and comparative genome-wide gene expression analysis of red cells versus wild-type cells. Planta, 2011. 233(4): p. 787-805 [PMID:21210143] Feng Y, et al. A three-component gene expression system and its application for inducible flavonoid overproduction in transgenic Arabidopsis thaliana. PLoS ONE, 2011. 6(3): p. e17603 [PMID:21408135] Lewis DR, et al. Auxin and ethylene induce flavonol accumulation through distinct transcriptional networks. Plant Physiol., 2011. 156(1): p. 144-64 [PMID:21427279] Appelhagen I, et al. TRANSPARENT TESTA1 interacts with R2R3-MYB factors and affects early and late steps of flavonoid biosynthesis in the endothelium of Arabidopsis thaliana seeds. Plant J., 2011. 67(3): p. 406-19 [PMID:21477081] Luo QJ,Mittal A,Jia F,Rock CD An autoregulatory feedback loop involving PAP1 and TAS4 in response to sugars in Arabidopsis. Plant Mol. Biol., 2012. 80(1): p. 117-29 [PMID:21533841] Peng Z, et al. Brassinosteroid enhances jasmonate-induced anthocyanin accumulation in Arabidopsis seedlings. J Integr Plant Biol, 2011. 53(8): p. 632-40 [PMID:21545406] Qi T, et al. The Jasmonate-ZIM-domain proteins interact with the WD-Repeat/bHLH/MYB complexes to regulate Jasmonate-mediated anthocyanin accumulation and trichome initiation in Arabidopsis thaliana. Plant Cell, 2011. 23(5): p. 1795-814 [PMID:21551388] Page M,Sultana N,Paszkiewicz K,Florance H,Smirnoff N The influence of ascorbate on anthocyanin accumulation during high light acclimation in Arabidopsis thaliana: further evidence for redox control of anthocyanin synthesis. Plant Cell Environ., 2012. 35(2): p. 388-404 [PMID:21631536] Hok S, et al. An Arabidopsis (malectin-like) leucine-rich repeat receptor-like kinase contributes to downy mildew disease. Plant Cell Environ., 2011. 34(11): p. 1944-57 [PMID:21711359] Gatica-Arias A, et al. Flavonoid production in transgenic hop (Humulus lupulus L.) altered by PAP1/MYB75 from Arabidopsis thaliana L. Plant Cell Rep., 2012. 31(1): p. 111-9 [PMID:21912858] Xie DY,Shi MZ Differentiation of programmed Arabidopsis cells. Bioeng Bugs, 2012. 3(1): p. 54-9 [PMID:22126737] Bonawitz ND, et al. REF4 and RFR1, subunits of the transcriptional coregulatory complex mediator, are required for phenylpropanoid homeostasis in Arabidopsis. J. Biol. Chem., 2012. 287(8): p. 5434-45 [PMID:22167189] Zhou LL,Shi MZ,Xie DY Regulation of anthocyanin biosynthesis by nitrogen in TTG1-GL3/TT8-PAP1-programmed red cells of Arabidopsis thaliana. Planta, 2012. 236(3): p. 825-37 [PMID:22669605] Das PK, et al. Cytokinins enhance sugar-induced anthocyanin biosynthesis in Arabidopsis. Mol. Cells, 2012. 34(1): p. 93-101 [PMID:22699753] Meinke DW A survey of dominant mutations in Arabidopsis thaliana. Trends Plant Sci., 2013. 18(2): p. 84-91 [PMID:22995285] Bhargava A, et al. The interacting MYB75 and KNAT7 transcription factors modulate secondary cell wall deposition both in stems and seed coat in Arabidopsis. Planta, 2013. 237(5): p. 1199-211 [PMID:23328896] Maier A, et al. Light and the E3 ubiquitin ligase COP1/SPA control the protein stability of the MYB transcription factors PAP1 and PAP2 involved in anthocyanin accumulation in Arabidopsis. Plant J., 2013. 74(4): p. 638-51 [PMID:23425305] Su L,Li A,Li H,Chu C,Qiu JL Direct modulation of protein level in Arabidopsis. Mol Plant, 2013. 6(5): p. 1711-4 [PMID:23455421] Shin DH, et al. HY5 regulates anthocyanin biosynthesis by inducing the transcriptional activation of the MYB75/PAP1 transcription factor in Arabidopsis. FEBS Lett., 2013. 587(10): p. 1543-7 [PMID:23583450] Qi T,Song S,Xie D Modified bimolecular fluorescence complementation assay to study the inhibition of transcription complex formation by JAZ proteins. Methods Mol. Biol., 2013. 1011: p. 187-97 [PMID:23615997] Ferr Arabidopsis TRANSCURVATA1 encodes NUP58, a component of the nucleopore central channel. PLoS ONE, 2013. 8(6): p. e67661 [PMID:23840761] Li S,Zachgo S TCP3 interacts with R2R3-MYB proteins, promotes flavonoid biosynthesis and negatively regulates the auxin response in Arabidopsis thaliana. Plant J., 2013. 76(6): p. 901-13 [PMID:24118612] Zhang Y, et al. Pathway engineering for phenolic acid accumulations in Salvia miltiorrhiza by combinational genetic manipulation. Metab. Eng., 2014. 21: p. 71-80 [PMID:24269612] Nakabayashi R, et al. Enhancement of oxidative and drought tolerance in Arabidopsis by overaccumulation of antioxidant flavonoids. Plant J., 2014. 77(3): p. 367-79 [PMID:24274116] Schnaubelt D, et al. Low glutathione regulates gene expression and the redox potentials of the nucleus and cytosol in Arabidopsis thaliana. Plant Cell Environ., 2015. 38(2): p. 266-79 [PMID:24329757] Liu W, et al. Synthetic TAL effectors for targeted enhancement of transgene expression in plants. Plant Biotechnol. J., 2014. 12(4): p. 436-46 [PMID:24373379] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Qiu J, et al. Arabidopsis AtPAP1 transcription factor induces anthocyanin production in transgenic Taraxacum brevicorniculatum. Plant Cell Rep., 2014. 33(4): p. 669-80 [PMID:24556963] Onkokesung N, et al. Modulation of flavonoid metabolites in Arabidopsis thaliana through overexpression of the MYB75 transcription factor: role of kaempferol-3,7-dirhamnoside in resistance to the specialist insect herbivore Pieris brassicae. J. Exp. Bot., 2014. 65(8): p. 2203-17 [PMID:24619996] Jones AM, et al. Border control--a membrane-linked interactome of Arabidopsis. Science, 2014. 344(6185): p. 711-6 [PMID:24833385] Cna'ani A, et al. Petunia Plant Cell Environ., 2015. 38(7): p. 1333-46 [PMID:25402319] Ilk N,Ding J,Ihnatowicz A,Koornneef M,Reymond M Natural variation for anthocyanin accumulation under high-light and low-temperature stress is attributable to the ENHANCER OF AG-4 2 (HUA2) locus in combination with PRODUCTION OF ANTHOCYANIN PIGMENT1 (PAP1) and PAP2. New Phytol., 2015. 206(1): p. 422-35 [PMID:25425527] Li T, et al. Jasmonic acid enhancement of anthocyanin accumulation is dependent on phytochrome A signaling pathway under far-red light in Arabidopsis. Biochem. Biophys. Res. Commun., 2014. 454(1): p. 78-83 [PMID:25450360] Shin DH, et al. Identification of genes that may regulate the expression of the transcription factor production of anthocyanin pigment 1 (PAP1)/MYB75 involved in Arabidopsis anthocyanin biosynthesis. Plant Cell Rep., 2015. 34(5): p. 805-15 [PMID:25604992] Tian J, et al. McMYB10 regulates coloration via activating McF3'H and later structural genes in ever-red leaf crabapple. Plant Biotechnol. J., 2015. 13(7): p. 948-61 [PMID:25641214] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Wang L,ZengJ HQ,Song J,Feng SJ,Yang ZM miRNA778 and SUVH6 are involved in phosphate homeostasis in Arabidopsis. Plant Sci., 2015. 238: p. 273-85 [PMID:26259194] Lotkowska ME, et al. The Arabidopsis Transcription Factor MYB112 Promotes Anthocyanin Formation during Salinity and under High Light Stress. Plant Physiol., 2015. 169(3): p. 1862-80 [PMID:26378103] Boter M, et al. FILAMENTOUS FLOWER Is a Direct Target of JAZ3 and Modulates Responses to Jasmonate. Plant Cell, 2015. 27(11): p. 3160-74 [PMID:26530088] He X,Li Y,Lawson D,Xie DY Metabolic engineering of anthocyanins in dark tobacco varieties. Physiol Plant, 2017. 159(1): p. 2-12 [PMID:27229540] Broeckling BE,Watson RA,Steinwand B,Bush DR Intronic Sequence Regulates Sugar-Dependent Expression of Arabidopsis thaliana Production of Anthocyanin Pigment-1/MYB75. PLoS ONE, 2016. 11(6): p. e0156673 [PMID:27248141] Li Y, et al. Two IIIf Clade-bHLHs from Freesia hybrida Play Divergent Roles in Flavonoid Biosynthesis and Trichome Formation when Ectopically Expressed in Arabidopsis. Sci Rep, 2016. 6: p. 30514 [PMID:27465838] Lee WJ, et al. Drastic anthocyanin increase in response to PAP1 overexpression in fls1 knockout mutant confers enhanced osmotic stress tolerance in Arabidopsis thaliana. Plant Cell Rep., 2016. 35(11): p. 2369-2379 [PMID:27562381] Khare D, et al. Root avoidance of toxic metals requires the GeBP-LIKE 4 transcription factor in Arabidopsis thaliana. New Phytol., 2017. 213(3): p. 1257-1273 [PMID:27768815] Li S, et al. MYB75 Phosphorylation by MPK4 Is Required for Light-Induced Anthocyanin Accumulation in Arabidopsis. Plant Cell, 2016. 28(11): p. 2866-2883 [PMID:27811015] Sawano H, et al. Double-stranded RNA-binding protein DRB3 negatively regulates anthocyanin biosynthesis by modulating PAP1 expression in Arabidopsis thaliana. J. Plant Res., 2017. 130(1): p. 45-55 [PMID:27995376] Zou B, et al. Calmodulin-binding protein CBP60g functions as a negative regulator in Arabidopsis anthocyanin accumulation. PLoS ONE, 2017. 12(3): p. e0173129 [PMID:28253311] Zhang Y, et al. GA-DELLA pathway is involved in regulation of nitrogen deficiency-induced anthocyanin accumulation. Plant Cell Rep., 2017. 36(4): p. 557-569 [PMID:28275852] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Xu Z,Mahmood K,Rothstein SJ ROS Induces Anthocyanin Production Via Late Biosynthetic Genes and Anthocyanin Deficiency Confers the Hypersensitivity to ROS-Generating Stresses in Arabidopsis. Plant Cell Physiol., 2017. 58(8): p. 1364-1377 [PMID:28586465] Park JJ,Dempewolf E,Zhang W,Wang ZY RNA-guided transcriptional activation via CRISPR/dCas9 mimics overexpression phenotypes in Arabidopsis. PLoS ONE, 2017. 12(6): p. e0179410 [PMID:28622347] Lowder LG,Paul JW,Qi Y Multiplexed Transcriptional Activation or Repression in Plants Using CRISPR-dCas9-Based Systems. Methods Mol. Biol., 2017. 1629: p. 167-184 [PMID:28623586] Kataya ARA, et al. PLATINUM SENSITIVE 2 LIKE impacts growth, root morphology, seed set, and stress responses. PLoS ONE, 2017. 12(7): p. e0180478 [PMID:28678890] Duan S, et al. Functional characterization of a heterologously expressed Brassica napus WRKY41-1 transcription factor in regulating anthocyanin biosynthesis in Arabidopsis thaliana. Plant Sci., 2018. 268: p. 47-53 [PMID:29362083] Kranz HD, et al. Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana. Plant J., 1998. 16(2): p. 263-76 [PMID:9839469]