PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EMT32723

Organism

Aegilops tauschii

Taxonomic ID

37682

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops

Family

bZIP

Protein Properties

Length: 176aa MW: 19216.3 Da PI: 7.3595

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EMT32723	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	23.8	9.5e-08	82	128	5	51
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 + rr NR A r++R++Kk+ ++ L+e+++ L a N++L k+++ EMT32723 82 SKKRRPSGNRAAVRKYREKKKEHTAVLQEEAARLRAMNEQLTKKVQD 128 56677788*********************************999874 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	5.9E-7	72	145	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	2.3E-13	80	146	No hit	No description
PROSITE profile	PS50217	8.703	80	127	IPR004827	Basic-leucine zipper domain
Pfam	PF07716	3.6E-12	82	127	IPR004827	Basic-leucine zipper domain
CDD	cd14686	8.21E-10	83	128	No hit	No description
SuperFamily	SSF57959	1.75E-6	90	144	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 176 aa Download sequence Send to blast
MDDGDLDFSS MSMGSYFDDV LGGAAEHLAC CTHTHTCNPP AHDLPHSHTC HHVHSKFAAS 60 ASSDAAADSP TEPEDAHATS RSKKRRPSGN RAAVRKYREK KKEHTAVLQE EAARLRAMNE 120 QLTKKVQDHA ALEAEAARLR CLLVDVRGRI EGEIGAFPYQ RRAAKSDECK PGTGTN

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	94	102	RKYREKKKE

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporter ZIP12 during growth in zinc-deficient conditions. ZIP12 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269\|PubMed:20479230, ECO:0000269\|PubMed:26306426}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by zinc deficiency. {ECO:0000269\|PubMed:20479230}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK354735	1e-168	AK354735.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1010J17.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020164422.1	1e-119	basic leucine zipper 23-like
Swissprot	Q8GTS2	8e-52	BZP23_ARATH; Basic leucine zipper 23
TrEMBL	M8CEU6	1e-127	M8CEU6_AEGTA; Uncharacterized protein
STRING	EMT32723	1e-127	(Aegilops tauschii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP4175	35	72

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G16770.1	8e-46	bZIP family protein

Publications ? help Back to Top
Azevedo H, et al. Transcriptomic profiling of Arabidopsis gene expression in response to varying micronutrient zinc supply. Genom Data, 2016. 7: p. 256-8 [PMID:26981422] Castro PH, et al. Phylogenetic analysis of F-bZIP transcription factors indicates conservation of the zinc deficiency response across land plants. Sci Rep, 2017. 7(1): p. 3806 [PMID:28630437] Nazri AZ,Griffin JHC,Peaston KA,Alexander-Webber DGA,Williams LE F-group bZIPs in barley-a role in Zn deficiency. Plant Cell Environ., 2017. 40(11): p. 2754-2770 [PMID:28763829] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470]