PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EMT32714

Organism

Aegilops tauschii

Taxonomic ID

37682

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops

Family

bZIP

Protein Properties

Length: 188aa MW: 20485 Da PI: 7.3565

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EMT32714	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	20.2	1.3e-06	79	124	6	51
HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 + rr N A r++R++Kka ++ Lee+++ L a N++L+k+++ EMT32714 79 KRRRPSGNQAAVRKYREKKKAHTALLEEEAARLRAMNEQLAKKVQD 124 55666779*********************************99874 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	1.1E-4	74	141	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	8.9E-12	76	142	No hit	No description
Pfam	PF07716	7.4E-11	78	123	IPR004827	Basic-leucine zipper domain
CDD	cd14686	1.07E-9	79	124	No hit	No description
SuperFamily	SSF57959	1.44E-5	86	140	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 188 aa Download sequence Send to blast
MDDGNLDCSS MGSYFDDILM DTEQVACTHT HTCNPPAHHL PHTHTCLHVH SKIAASASSD 60 AGAETPAGFE DAHATSRSKR RRPSGNQAAV RKYREKKKAH TALLEEEAAR LRAMNEQLAK 120 KVQDHAALEA EAARLRCLLV DVRGRIEGEI GAFPYHRRPA KGAGQGGAQV MSSCDFIATC 180 EQPHTCFL

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporters ZIP3, ZIP4, ZIP5 and ZIP9 during growth in zinc-deficient conditions. ZIP9 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269\|PubMed:20479230, ECO:0000269\|PubMed:26306426}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by zinc deficiency. {ECO:0000269\|PubMed:20479230}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK354735	1e-163	AK354735.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1010J17.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020163269.1	1e-138	basic leucine zipper 19-like
Swissprot	Q8VY76	6e-53	BZP19_ARATH; Basic leucine zipper 19
TrEMBL	M8CE93	1e-137	M8CE93_AEGTA; Uncharacterized protein
STRING	EMT32714	1e-138	(Aegilops tauschii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP4175	35	72

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G16770.1	8e-41	bZIP family protein

Publications ? help Back to Top
Azevedo H, et al. Transcriptomic profiling of Arabidopsis gene expression in response to varying micronutrient zinc supply. Genom Data, 2016. 7: p. 256-8 [PMID:26981422] Castro PH, et al. Phylogenetic analysis of F-bZIP transcription factors indicates conservation of the zinc deficiency response across land plants. Sci Rep, 2017. 7(1): p. 3806 [PMID:28630437] Henriques AR,Farias DDR,Costa de Oliveira A Identification and characterization of the bZIP transcription factor involved in zinc homeostasis in cereals. Genet. Mol. Res., 2017. [PMID:28671251] Nazri AZ,Griffin JHC,Peaston KA,Alexander-Webber DGA,Williams LE F-group bZIPs in barley-a role in Zn deficiency. Plant Cell Environ., 2017. 40(11): p. 2754-2770 [PMID:28763829] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470]