PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EMT25213

Organism

Aegilops tauschii

Taxonomic ID

37682

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops

Family

M-type_MADS

Protein Properties

Length: 63aa MW: 7199.47 Da PI: 10.8125

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EMT25213	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	100.7	5.6e-32	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr g+lKKA+E+SvLCdaev +iifs++gklye+s+ EMT25213 9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVGLIIFSTKGKLYEFST 59 79***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	32.941	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	2.9E-40	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	4.07E-36	2	63	No hit	No description
SuperFamily	SSF55455	6.15E-30	2	61	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.6E-32	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.3E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.6E-32	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.6E-32	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 63 aa Download sequence Send to blast
MGRGKVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVGLIIFST KGKLYEFSTE 60 SCR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	6e-20	1	59	1	59	MEF2C
5f28_B	6e-20	1	59	1	59	MEF2C
5f28_C	6e-20	1	59	1	59	MEF2C
5f28_D	6e-20	1	59	1	59	MEF2C
6byy_A	7e-20	1	59	1	59	MEF2 CHIMERA
6byy_B	7e-20	1	59	1	59	MEF2 CHIMERA
6byy_C	7e-20	1	59	1	59	MEF2 CHIMERA
6byy_D	7e-20	1	59	1	59	MEF2 CHIMERA
6bz1_A	7e-20	1	59	1	59	MEF2 CHIMERA
6bz1_B	7e-20	1	59	1	59	MEF2 CHIMERA
6bz1_C	7e-20	1	59	1	59	MEF2 CHIMERA
6bz1_D	7e-20	1	59	1	59	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	GQ451779	7e-99	GQ451779.1 Triticum aestivum isolate 97D7_20_02_09 vernalization protein (Vrn1) gene, Vrn1-D1 allele, promoter region, exon1 and partial cds.
GenBank	GQ451782	7e-99	GQ451782.1 Triticum aestivum isolate 98B vernalization protein (Vrn1) gene, Vrn1-B1 allele, promoter region, exon1 and partial cds.
GenBank	GQ451783	7e-99	GQ451783.1 Triticum aestivum isolate 98D_1_20_03_09 vernalization protein (Vrn1) gene, Vrn1-D1 allele, promoter region, exon1 and partial cds.
GenBank	GQ451785	7e-99	GQ451785.1 Triticum aestivum isolate 99B vernalization protein (Vrn1) gene, Vrn1-B1 allele, promoter region, exon1 and partial cds.
GenBank	GQ451786	7e-99	GQ451786.1 Triticum aestivum isolate 99D_1_20_03_09 vernalization protein (Vrn1) gene, Vrn1-D1 allele, promoter region, exon1 and partial cds.
GenBank	GQ451787	7e-99	GQ451787.1 Triticum aestivum isolate 99D_3_20_03_09 vernalization protein (Vrn1) gene, Vrn1-D1 allele, promoter region, exon1 and partial cds.
GenBank	GQ451791	7e-99	GQ451791.1 Triticum aestivum isolate 100B vernalization protein (Vrn1) gene, Vrn1-B1 allele, promoter region, exon1 and partial cds.
GenBank	GQ451797	7e-99	GQ451797.1 Triticum aestivum isolate 101B vernalization protein (Vrn1) gene, Vrn1-B1 allele, promoter region, exon1 and partial cds.
GenBank	GQ451802	7e-99	GQ451802.1 Triticum aestivum isolate 102D23_27_02_09 vernalization protein (Vrn1) gene, Vrn1-D1 allele, promoter region, exon1 and partial cds.
GenBank	GQ451809	7e-99	GQ451809.1 Triticum aestivum isolate 105D8_06_03_09 vernalization protein (Vrn1) gene, Vrn1-D1 allele, promoter region, exon1 and partial cds.
GenBank	GQ451811	7e-99	GQ451811.1 Triticum aestivum isolate 106B vernalization protein (Vrn1) gene, Vrn1-B1 allele, promoter region, exon1 and partial cds.
GenBank	GQ451812	7e-99	GQ451812.1 Triticum aestivum isolate 106D3+D6_06_03_09 vernalization protein (Vrn1) gene, Vrn1-D1 allele, promoter region, exon1 and partial cds.
GenBank	GQ451814	7e-99	GQ451814.1 Triticum aestivum isolate 113_7_3_02_09 vernalization protein (Vrn1) gene, Vrn1-B1 allele, promoter region, exon1 and partial cds.
GenBank	GQ451818	7e-99	GQ451818.1 Triticum turgidum subsp. turanicum isolate 118B vernalization protein (Vrn1) gene, Vrn1-B1 allele, promoter region, exon1 and partial cds.
GenBank	GQ451820	7e-99	GQ451820.1 Triticum turgidum isolate 119B vernalization protein (Vrn1) gene, Vrn1-B1 allele, promoter region, exon1 and partial cds.
GenBank	HQ130482	7e-99	HQ130482.2 Triticum aestivum cultivar Saratovskaya29 Vrn-B1 (Vrn-B1) gene, Vrn-B1-c allele, promoter region and complete cds.
GenBank	HQ130483	7e-99	HQ130483.2 Triticum aestivum cultivar Diamant2 Vrn-B1 (Vrn-B1) gene, Vrn-B1-a allele, promoter region and complete cds.
GenBank	HQ593668	7e-99	HQ593668.1 Triticum aestivum Vrn-B1c (Vrn-B1c) gene, intron 1 and partial cds.
GenBank	JN817430	7e-99	JN817430.1 Triticum carthlicum genotype PI 94749 retrotransposon VRN, complete sequence; and VRN-B1 (VRN-B1) gene, complete cds.
GenBank	JN817431	7e-99	JN817431.1 Triticum durum cultivar Lebsock Vrn-B1 (VRN-B1) gene, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020198021.1	1e-37	MADS-box transcription factor 14-like
Swissprot	O22328	7e-36	AGL8_SOLCO; Agamous-like MADS-box protein AGL8 homolog
TrEMBL	M8BTT4	2e-37	M8BTT4_AEGTA; Agamous-like MADS-box AGL8-like protein
STRING	EMT25213	3e-38	(Aegilops tauschii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP129	38	398

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G60910.1	8e-37	AGAMOUS-like 8