PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EMT19812 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 146aa MW: 16100 Da PI: 10.1298 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 62.8 | 4e-20 | 23 | 57 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C+ C+tt+Tp+WR+gp g++tLCnaCG++yrkk++ EMT19812 23 CVECRTTTTPMWRSGPTGPRTLCNACGIRYRKKRR 57 ********************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 2.6E-16 | 17 | 67 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 4.18E-14 | 19 | 59 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 1.1E-15 | 21 | 58 | IPR013088 | Zinc finger, NHR/GATA-type |
PROSITE profile | PS50114 | 12.664 | 23 | 53 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 23 | 48 | IPR000679 | Zinc finger, GATA-type |
CDD | cd00202 | 2.54E-14 | 23 | 58 | No hit | No description |
Pfam | PF00320 | 9.6E-18 | 23 | 57 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009416 | Biological Process | response to light stimulus | ||||
GO:0048527 | Biological Process | lateral root development | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 146 aa Download sequence Send to blast |
MDSSHHKVIG VAPAAAEGGR MCCVECRTTT TPMWRSGPTG PRTLCNACGI RYRKKRRQEL 60 GLDNKPQNQQ LNQQQQHQQQ QQQQQQQRED HGEATSAVKD SSSSSNNKSS NLQVVKKKRT 120 VSMGVEEAAF LLMALSSSST PPLLHG |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK250674 | 1e-99 | AK250674.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf93f15, mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020179907.1 | 1e-105 | GATA transcription factor 17-like | ||||
TrEMBL | A0A3B5ZS13 | 1e-104 | A0A3B5ZS13_WHEAT; Uncharacterized protein | ||||
TrEMBL | R7WBD7 | 1e-104 | R7WBD7_AEGTA; GATA transcription factor 22 | ||||
STRING | EMT19812 | 1e-105 | (Aegilops tauschii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6721 | 28 | 54 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26930.1 | 7e-19 | GATA transcription factor 23 |