PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EMT16619 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 136aa MW: 14796.1 Da PI: 7.5696 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 68.7 | 8.8e-22 | 44 | 99 | 2 | 58 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 +Dgy+W+KYGqK +k+ + rsY+rC ++C +kkkve + dp++ ++Y g H+h EMT16619 44 EDGYQWKKYGQKFIKNIQKIRSYFRCRDKRCGAKKKVEWQPGDPNL-RVVYDGAHQH 99 7****************************************99985.899******9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50811 | 18.234 | 38 | 102 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.19E-20 | 41 | 102 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 4.3E-23 | 41 | 102 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.4E-21 | 43 | 101 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.8E-20 | 44 | 99 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 136 aa Download sequence Send to blast |
MASTSQPPTT GNEGGERGHH GDEEEQQQGA WAEAAGGQPL VMPEDGYQWK KYGQKFIKNI 60 QKIRSYFRCR DKRCGAKKKV EWQPGDPNLR VVYDGAHQHG SPSSNGGGQD ADGAANRYDL 120 STQYFGGAGA PTPQTQ |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JQ806389 | 1e-101 | JQ806389.1 Hordeum vulgare WRKY transcript factor 48 (WRKY48) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020162458.1 | 1e-97 | WRKY transcription factor WRKY24-like isoform X2 | ||||
Refseq | XP_020181478.1 | 1e-97 | WRKY transcription factor WRKY24-like isoform X2 | ||||
TrEMBL | A0A3B6JDE4 | 3e-96 | A0A3B6JDE4_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A453H114 | 3e-96 | A0A453H114_AEGTS; Uncharacterized protein | ||||
TrEMBL | R7WD66 | 3e-96 | R7WD66_AEGTA; Uncharacterized protein | ||||
STRING | EMT16619 | 6e-97 | (Aegilops tauschii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP10158 | 34 | 44 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69310.2 | 7e-15 | WRKY DNA-binding protein 57 |