PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EMT11192 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 200aa MW: 22867 Da PI: 8.9688 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 178.7 | 1.5e-55 | 41 | 170 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 +ppGfrFhPtdeelv +yL+kkv+++k++l +vi+++d+y++ePwdL + ++e++ewyfFs +d+ky+tg+r+nrat +g+Wkatg+dk+v++ +++ EMT11192 41 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIRDIDLYRIEPWDLTEhcgIGYEEQNEWYFFSFKDRKYPTGTRTNRATMAGFWKATGRDKAVHE-RSR 139 69****************************.9***************853543334677*************************************9.999 PP NAM 99 lvglkktLvfykgrapkgektdWvmheyrle 129 l+g++ktLvfykgrap+g+ktdW+mheyrle EMT11192 140 LIGMRKTLVFYKGRAPNGQKTDWIMHEYRLE 170 *****************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.83E-57 | 38 | 182 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 55.12 | 41 | 189 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.2E-29 | 42 | 169 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0048759 | Biological Process | xylem vessel member cell differentiation | ||||
GO:1901348 | Biological Process | positive regulation of secondary cell wall biogenesis | ||||
GO:1990110 | Biological Process | callus formation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 200 aa Download sequence Send to blast |
MSASGQQKGH RALGVPWNSS TKGQGGSGGG VDHMDSMESC VPPGFRFHPT DEELVGYYLR 60 KKVASQKIDL DVIRDIDLYR IEPWDLTEHC GIGYEEQNEW YFFSFKDRKY PTGTRTNRAT 120 MAGFWKATGR DKAVHERSRL IGMRKTLVFY KGRAPNGQKT DWIMHEYRLE TDENAPPQAS 180 YKLSTVLLLP FPTLVLIKEM |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 8e-51 | 38 | 169 | 12 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00266 | DAP | Transfer from AT2G18060 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by chitin (e.g. chitooctaose) (PubMed:17722694). Accumulates in plants exposed to callus induction medium (CIM) (PubMed:17581762). {ECO:0000269|PubMed:17581762, ECO:0000269|PubMed:17722694}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JQ693422 | 0.0 | JQ693422.1 Brachypodium distachyon SWN1 (SWN1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020152633.1 | 1e-107 | NAC domain-containing protein 37-like | ||||
Refseq | XP_020186463.1 | 1e-107 | NAC domain-containing protein 37-like | ||||
Refseq | XP_022678630.1 | 1e-107 | NAC domain-containing protein 37 isoform X1 | ||||
Swissprot | Q9SL41 | 3e-95 | NAC37_ARATH; NAC domain-containing protein 37 | ||||
TrEMBL | M8B384 | 1e-149 | M8B384_AEGTA; NAC domain-containing protein 7 | ||||
STRING | EMT11192 | 1e-150 | (Aegilops tauschii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3625 | 37 | 68 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G18060.1 | 3e-97 | vascular related NAC-domain protein 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|