PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EMT10691 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 183aa MW: 20499.1 Da PI: 10.0724 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.2 | 1.7e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT Ede l+ +vk +G g+Wk ++ + g++R++k+c++rw++yl EMT10691 14 RGAWTSKEDETLASYVKAHGEGRWKQVPLKAGLRRCGKSCRLRWLNYL 61 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 52.4 | 1.2e-16 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+ + +E+el+v+++++lG++ W++Ia +++ gRt++++k++w++ EMT10691 67 RGNISDDEEELIVRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNST 111 7899******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.353 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.77E-28 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.2E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.1E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.4E-23 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.74E-9 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 25.042 | 62 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 5.8E-15 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.1E-14 | 67 | 111 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.0E-23 | 69 | 115 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.71E-11 | 71 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006633 | Biological Process | fatty acid biosynthetic process | ||||
GO:0006970 | Biological Process | response to osmotic stress | ||||
GO:0010023 | Biological Process | proanthocyanidin biosynthetic process | ||||
GO:0090379 | Biological Process | secondary cell wall biogenesis involved in seed trichome differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 183 aa Download sequence Send to blast |
MGRRAWSAKE GVKRGAWTSK EDETLASYVK AHGEGRWKQV PLKAGLRRCG KSCRLRWLNY 60 LRPSIKRGNI SDDEEELIVR LHRLLGNRWS LIAGRLPGRT DNEIKNYWNS TLGRKALPER 120 SATRMGRLFF RGDARAVGGD GDECSGSSLV ASSGGGDWMD DVRALASFLE SDDDWVNSLQ 180 MAD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-26 | 14 | 116 | 7 | 108 | B-MYB |
1h8a_C | 2e-26 | 12 | 116 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK358937 | 1e-161 | AK358937.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1086B18. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020156286.1 | 1e-120 | anthocyanin regulatory C1 protein-like | ||||
Swissprot | P10290 | 7e-67 | MYBC_MAIZE; Anthocyanin regulatory C1 protein | ||||
TrEMBL | M8B9L6 | 1e-128 | M8B9L6_AEGTA; Anthocyanin regulatory C1 protein | ||||
STRING | EMT10691 | 1e-129 | (Aegilops tauschii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP116 | 37 | 448 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G35550.1 | 2e-57 | MYB family protein |