PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EMT08953

Organism

Aegilops tauschii

Taxonomic ID

37682

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops

Family

bZIP

Protein Properties

Length: 101aa MW: 10966.4 Da PI: 10.7448

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EMT08953	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	37.1	6.9e-12	21	71	12	62
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 12 kNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 +NR++A+ R+RKka++ eLe k+k Le N +L +++++l++e +l++ EMT08953 21 RNRVSAQQARERKKAYMTELEVKAKDLELRNAELEQKVSTLQNENNTLRQI 71 9*********************************************99986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	6.5E-9	13	74	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	2.2E-10	20	72	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	3.63E-12	20	72	No hit	No description
CDD	cd14704	4.29E-16	21	65	No hit	No description
Gene3D	G3DSA:1.20.5.170	5.5E-16	21	74	No hit	No description
PROSITE profile	PS50217	10.691	21	75	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 101 aa Download sequence Send to blast
MVEWADGGAA KPTVVVGLSS RNRVSAQQAR ERKKAYMTEL EVKAKDLELR NAELEQKVST 60 LQNENNTLRQ ILKNTTAHAG KKSSGGKGGD GGKKHHHFGK G

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that promotes photomorphogenesis in the light and positively regulates fruit pigmentation and fruit nutritional quality. Probably acts downstream of the light receptor network and directly affects transcription of light-induced genes. {ECO:0000269\|PubMed:15178762}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK365648	3e-96	AK365648.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2035O05.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020188760.1	8e-52	transcription factor HY5-like
Swissprot	Q9SM50	1e-22	HY5_SOLLC; Transcription factor HY5
TrEMBL	M8C179	7e-67	M8C179_AEGTA; Transcription factor HY5
STRING	EMT08953	1e-67	(Aegilops tauschii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1408	38	111

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G11260.1	7e-24	bZIP family protein

Publications ? help Back to Top
Wang F, et al. Light Signaling-Dependent Regulation of Photoinhibition and Photoprotection in Tomato. Plant Physiol., 2018. 176(2): p. 1311-1326 [PMID:29146776] Liu CC, et al. The bZip transcription factor HY5 mediates CRY1a-induced anthocyanin biosynthesis in tomato. Plant Cell Environ., 2018. 41(8): p. 1762-1775 [PMID:29566255]