PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EMT03036 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 221aa MW: 24305.9 Da PI: 6.1594 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 62.5 | 8.2e-20 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg WT+eEd +l+ +++q+G+++W++I++ g+ R++k+c++rw +yl EMT03036 14 RGQWTPEEDNKLLSYITQHGTRNWRLIPKNAGLQRCGKSCRLRWTNYL 61 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 46.2 | 1e-14 | 68 | 110 | 2 | 46 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 g +T E++ +++++ G++ W+ Ia+ ++ gRt++++k++w++ EMT03036 68 GEFTDAEEQTIIKLHSVVGNR-WSVIAAQLP-GRTDNDVKNHWNT 110 789******************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.7E-26 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 26.91 | 9 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.67E-30 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.0E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.4E-17 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.60E-13 | 17 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 8.6E-25 | 65 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.8E-14 | 66 | 114 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 20.197 | 66 | 116 | IPR017930 | Myb domain |
Pfam | PF00249 | 3.1E-13 | 68 | 110 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.09E-10 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010090 | Biological Process | trichome morphogenesis | ||||
GO:0048658 | Biological Process | anther wall tapetum development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 221 aa Download sequence Send to blast |
MGRIPCCEKD NVKRGQWTPE EDNKLLSYIT QHGTRNWRLI PKNAGLQRCG KSCRLRWTNY 60 LRPDLKHGEF TDAEEQTIIK LHSVVGNRWS VIAAQLPGRT DNDVKNHWNT KLKKKLSGMG 120 IDPATEFRYE GTASGYVLGG DGDQGTSMWS HHSMYSGSSG TEGGRPALQE KGNDSVGSSG 180 GDEEAEDGKE GGKGASDMSG LFGSDCVLWD LPDELTNHMC D |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 7e-30 | 14 | 116 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Essential for tapetum development in anthers and microsporogenesis. May regulate the timing of tapetal programmed cell death (PCD) which is critical for pollen development. {ECO:0000269|PubMed:22086333}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00564 | DAP | Transfer from AT5G56110 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT034238 | 1e-163 | BT034238.1 Zea mays full-length cDNA clone ZM_BFc0028K07 mRNA, complete cds. | |||
GenBank | BT039422 | 1e-163 | BT039422.1 Zea mays full-length cDNA clone ZM_BFc0012M19 mRNA, complete cds. | |||
GenBank | BT040670 | 1e-163 | BT040670.1 Zea mays full-length cDNA clone ZM_BFc0113I05 mRNA, complete cds. | |||
GenBank | BT043240 | 1e-163 | BT043240.1 Zea mays full-length cDNA clone ZM_BFc0129J22 mRNA, complete cds. | |||
GenBank | BT054988 | 1e-163 | BT054988.1 Zea mays full-length cDNA clone ZM_BFc0168O09 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016718412.1 | 4e-93 | PREDICTED: transcription factor MYB35-like | ||||
Swissprot | Q7XQN1 | 2e-87 | MYB80_ORYSJ; Transcription factor MYB80 | ||||
TrEMBL | N1QRR4 | 1e-163 | N1QRR4_AEGTA; Myb-related protein Pp2 | ||||
STRING | EMT03036 | 1e-164 | (Aegilops tauschii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP10867 | 33 | 39 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G56110.1 | 2e-82 | myb domain protein 103 |