PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT01567
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family ARF
Protein Properties Length: 1052aa    MW: 117874 Da    PI: 6.8439
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT01567genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B370.32.6e-2292193199
               EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
        B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
               f+k+lt sd++++g +++p++ ae++       ++++++  +l+ +d++   W++++i+r++++r++lt+GW+ Fv+ ++L +gD+v+F   ++++ +l++
  EMT01567  92 FCKTLTASDTSTHGGFSVPRRAAEKIfppldftMQPPAQ--ELMAKDLHDIPWKFRHIFRGQPKRHLLTTGWSVFVSTKRLLAGDSVLFI--RDEKSQLLL 188
               99*****************************96555544..8************************************************..456777899 PP

               EEE-S CS
        B3  95 kvfrk 99 
               +++r+
  EMT01567 189 GIRRA 193
               99997 PP

2Auxin_resp122.92.3e-40218300183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 aahaa+++s+F+++YnPras+seFv++++k++kal+++vs+GmRf+m feteds  rr++Gt++g+ dldpvrW+nS+Wr+L+
    EMT01567 218 AAHAAANSSPFTIFYNPRASPSEFVIPLAKYNKALYTQVSLGMRFRMLFETEDSGVRRYMGTITGIGDLDPVRWKNSHWRNLQ 300
                 79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.62E-4382221IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.109.5E-4084207IPR015300DNA-binding pseudobarrel domain
CDDcd100171.40E-1891192No hitNo description
PROSITE profilePS5086311.87192194IPR003340B3 DNA binding domain
PfamPF023623.1E-2092193IPR003340B3 DNA binding domain
SMARTSM010191.8E-2192194IPR003340B3 DNA binding domain
PfamPF065073.8E-35218300IPR010525Auxin response factor
PROSITE profilePS5174519.1719651051IPR000270PB1 domain
SuperFamilySSF542778.63E-59821034No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010311Biological Processlateral root formation
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 1052 aa     Download sequence    Send to blast
MPPVGSLVVY FPQGHSEQVA ASMHKEVDII PNYPSLPSKL ICKLLSLTLH ADSETDEVYA  60
QMTLQPVNKY DRDAMLASEL GLKQNKQPVE FFCKTLTASD TSTHGGFSVP RRAAEKIFPP  120
LDFTMQPPAQ ELMAKDLHDI PWKFRHIFRG QPKRHLLTTG WSVFVSTKRL LAGDSVLFIR  180
DEKSQLLLGI RRATRPQPAL SSSVLSSDSM HIGILAAAAH AAANSSPFTI FYNPRASPSE  240
FVIPLAKYNK ALYTQVSLGM RFRMLFETED SGVRRYMGTI TGIGDLDPVR WKNSHWRNLQ  300
VGWDESTASE RRTRVSIWEI EPVATPFYIC PPPFFRPKLP KQPGLPGDTN VGWDESTASE  360
RRTRVSIWEI EPVATPFYIC PPPFFRPKLP KQPGMPDDES EVDSAFKRAM PWLGDDFALK  420
DVQSQLFPGL SLVQWMAMQQ NPQMLPAGAP AVQAPYLNSS AMAMQDGMGT GNDDLMRRFN  480
MQGQNIGLPN SQQVGSKMDH PAMAQHQQQS HQLQQQQQVQ QSQQSSVVQQ QQAQLLQQNV  540
IHLQQQQEHL QRQQSLPQQQ QEHLQRQQSQ PQQQLKTAAS MPSMEQHKLR EQQPQGGQAV  600
SQAQMLSQIF QPSSSQLQQL GLPKSPTQRP GFPGLPTASS LQQPALGQAP QVQQAAEYQQ  660
ALLQSQQQQL QQLSQPEMQL QLLQKIQQQN MLSQLNPQHQ SQLMQQLSQK NQEYLQQQIL  720
QHQLSGSDAM VQFKQSHQTP SNNITGSLTP QQLVRSHSAL AESEDPSSST APSASRLSPM  780
NSLSRTHQGS RNLTDMTTSP HIDNLLQEIQ SKPDNRNKND MQSSKEAIPV PNRYPVSDQL  840
DASSATSFCL DESPREGFSF PPVCLDSNAQ VDPRDNFLIA ENVDSLMPDA LLSRGMGSGK  900
DICNLPSGQR DHREVDNELS SAAFSSQSFG VPDISFKPGC SGDIAVNDGG MPSQGLWNNQ  960
TQRMRTFTKV QKRGSVGRSI DITRYTNYDE LRHDLACMFG IQGQLEDPYR MDWKLVYVDH  1020
ENDILLVGDD PWECSANRLI AELLRLVPTK IR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-150132166388Auxin response factor 5
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin under dark condition. {ECO:0000269|PubMed:17408882}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3742620.0AK374262.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3058N24.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020149526.10.0auxin response factor 16
RefseqXP_020160269.10.0auxin response factor 16
SwissprotA3B9A00.0ARFP_ORYSJ; Auxin response factor 16
TrEMBLN1QRI90.0N1QRI9_AEGTA; Auxin response factor
STRINGEMT015670.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90453338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19
Publications ? help Back to Top
  1. Shen C, et al.
    OsARF16, a transcription factor, is required for auxin and phosphate starvation response in rice (Oryza sativa L.).
    Plant Cell Environ., 2013. 36(3): p. 607-20
    [PMID:22913536]
  2. Shen C, et al.
    OsARF16 is involved in cytokinin-mediated inhibition of phosphate transport and phosphate signaling in rice (Oryza sativa L.).
    PLoS ONE, 2014. 9(11): p. e112906
    [PMID:25386911]
  3. Shen C, et al.
    OsARF16, a transcription factor regulating auxin redistribution, is required for iron deficiency response in rice (Oryza sativa L.).
    Plant Sci., 2015. 231: p. 148-58
    [PMID:25576000]