PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 914765 | ||||||||
Common Name | ARALYDRAFT_914765 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 64aa MW: 7039.9 Da PI: 4.4885 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 33.2 | 1.4e-10 | 14 | 54 | 2 | 42 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHH CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLp 42 lkk+ye++++++++++isw +++sf+++d+e f+k +Lp 914765 14 LLKKTYEVVDHPSTNSIISWGPDNKSFIIWDPEGFEKFLLP 54 589******************999*************8876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 1.1E-10 | 6 | 54 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SuperFamily | SSF46785 | 1.36E-9 | 11 | 55 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
Pfam | PF00447 | 9.8E-8 | 15 | 54 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 64 aa Download sequence Send to blast |
MDSSSAMASQ ALDLLKKTYE VVDHPSTNSI ISWGPDNKSF IIWDPEGFEK FLLPYSGGSR 60 INF* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 914765 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002870167.2 | 2e-26 | heat stress transcription factor A-4a | ||||
TrEMBL | D7MGW4 | 9e-39 | D7MGW4_ARALL; Uncharacterized protein | ||||
STRING | scaffold_702507.1 | 2e-39 | (Arabidopsis lyrata) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G17750.1 | 5e-12 | heat shock factor 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 914765 |
Entrez Gene | 9306077 |